Felis catus (domestic cat): 102899259 Help Entry 102899259         CDS       T02385                                  Name (RefSeq) histone H2B type 2-E1 isoform X1   KO K11252   histone H2B Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05203   Viral carcinogenesis fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102899259  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102899259   09163 Immune disease    05322 Systemic lupus erythematosus     102899259   09165 Substance dependence    05034 Alcoholism     102899259  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     102899259   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     102899259 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102899259 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102899259 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TAF Motif Other DBs NCBI-GeneID:  102899259 NCBI-ProteinID:  XP_019681595 Ensembl:  ENSFCAG00000050168 LinkDB All DBs Position A2:complement(163333742..163336196) Genome browser AA seq 122 aa AA seqDB search MSAEHGQQQQSGGRRGRSSGDKKSKKRSRRKETYSMYIYKVLKQVHPDIGISSKAMSIMN SFVNDVFERLAGEAARLAQYSGRTTLTSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTS SK NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgagcgcagagcatggacagcagcagcagtcggggggccggaggggccgtagttccggc gacaagaagtccaaaaagcgcagccggcgcaaggagacctactcgatgtacatctacaag gtgctgaagcaggtgcaccctgacattggcatctcttccaaggccatgagcatcatgaat tcgtttgtgaacgatgtgtttgaacggctggctggcgaggctgcccggctggcccagtac tcgggccgaaccacactgacctcccgggaagtccagacggccgtgcgcctgctgctgccc ggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcaccaagtataccagc tccaagtga

DBGET integrated database retrieval system