KEGG   Felis catus (domestic cat): 102899461
Entry
102899461         CDS       T02385                                 
Symbol
CR1L
Name
(RefSeq) complement component receptor 1-like protein
  KO
K04011  complement component (3b/4b) receptor 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04610  Complement and coagulation cascades
fca04613  Neutrophil extracellular trap formation
fca04640  Hematopoietic cell lineage
fca05134  Legionellosis
fca05140  Leishmaniasis
fca05144  Malaria
fca05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102899461 (CR1L)
   04610 Complement and coagulation cascades
    102899461 (CR1L)
   04613 Neutrophil extracellular trap formation
    102899461 (CR1L)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    102899461 (CR1L)
   05152 Tuberculosis
    102899461 (CR1L)
  09174 Infectious disease: parasitic
   05144 Malaria
    102899461 (CR1L)
   05140 Leishmaniasis
    102899461 (CR1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    102899461 (CR1L)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    102899461 (CR1L)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    102899461 (CR1L)
CD molecules [BR:fca04090]
 Proteins
  102899461 (CR1L)
SSDB
Motif
Pfam: Sushi DUF1737
Other DBs
NCBI-GeneID: 102899461
NCBI-ProteinID: XP_011289266
LinkDB
Position
F1:complement(37226292..37289658)
AA seq 882 aa
MGASPRRSPQPLGPPAPPLSRSGGALLAVLLLLTLPAAWGNCKAPAQLPFARPTEPIEKF
EFPIGASLNYICRPGYYKKQFRITCQENLTWSSAENKCERKSCGTPPELINGRMTINGDT
KFGSTVNYACNEGYRLIGQPSSTCLISGNTVVWDNNPPTCERIPCGPPPNIANGSFTSIN
REYFPYGTVVTYRCNSGQRGKKPFELVGQPSIYCTSKDNRVGTWSGPPPQCIIPNKCTPP
EIENAIIVSERKTLYSLNEIVVFMCESGFDMKGPSSVKCQPRNRWEPQLPSCSRLCAPPP
EIPHGKPTPSDKDSFSPGQEVFYSCEPGYDLRGTASVRCTPQGNWSPAAPMCAVKSCDDF
LDQLPNGRVLFPLNFQLGAKVSFICNEGFRLKGSSASYCTLVEMKSLWNNSVPVCEQIFC
PSPPSILNGSHTGTPQGDVPYGEEITYMCDPRSARGMTFNLVGESTIRCTSDGEGNGIWS
GPAPYCEPAGPAGYCKAPKQFPFAKPATQTDESEFPVGTSLTFKCSPGYFESTFSITCLE
NLVWSSAEDTCRRKSCGAPPEPFNGMVHINTDTQFGSTVNYSCNEGYRLVGSPSAACHLS
GNTVTWDKETPICKKIFCPSPPSIPNGNYPRTSQGDVPYGEEVTYMCEPRSARGMTFNLV
GESTIRCTSDGEGNGIWSGPAPSCELAGPAACPHPPKIHNGHYIGEHPFPYLPGMTVSYT
CDPGYLLVGRNFIFCTYLGTWSHFEHYCREAKCRLPAHMNGIRKDVEMRKVYHHGDNVTF
ECEEGYTLKGSPQSQCQADNTWDPPLAICASSTHDALIAGIFFGTIFFLLPIIVAGWIIV
KHKQGKTTDEKCKESIHLHPQEDSGVSPQTVQTNQENSSVLP
NT seq 2649 nt   +upstreamnt  +downstreamnt
atgggagcctctcctcggaggagcccgcagcctctcgggccgccggcgccccctctctcc
cgctccggaggagccctcctcgcggttctgctgctgctcacgctgccggcggcctggggt
aattgcaaagccccggcacagctcccgtttgccaggcctacagaaccgattgagaagttt
gagtttcccattggggcatctttgaactacatatgccgccctggttactacaagaaacag
ttccgtatcacctgccaagagaatttgacctggtcaagtgctgaaaacaaatgtgaacgt
aaatcatgtggaactcctccagaactcataaatggcagaatgactataaacggagacacc
aagtttggatcaactgttaattatgcttgtaatgaaggataccgactcattggtcagccc
tctagcacgtgcctcatctcgggcaatactgtcgtctgggataacaacccacctacttgt
gaaagaattccttgtgggccgcccccaaacattgccaatggaagtttcactagcatcaac
agagaatattttccatacgggacggtggtgacctatcgctgcaattctggacagagaggg
aaaaagccgtttgagcttgtgggccagccgtcaatatattgcaccagcaaagacaaccgc
gtcggcacgtggagcggccctccccctcagtgcattatacctaataaatgcacacctccg
gaaattgaaaatgcaatcatagtatctgagcgcaaaaccttatattccttaaatgaaatc
gtggtgtttatgtgtgagtccggctttgacatgaaaggaccctccagtgtgaaatgccaa
cctcgaaacagatgggaaccacagctgccaagctgctctaggctatgtgcgccgcctcca
gaaattccgcatggtaagcccaccccaagcgacaaggacagtttttcccctgggcaggaa
gtattctacagttgtgagcctggctatgatctcagagggactgcttctgtgcgctgtacg
ccccagggaaactggagcccagcagcccctatgtgtgcagtgaaatcatgtgatgacttc
ctggaccaactccctaacggccgtgtgctctttccacttaatttccagcttggggcaaaa
gtgtccttcatttgcaatgaggggttccgtttaaagggaagttctgctagctactgtacc
ttggttgaaatgaaaagcctttggaacaacagtgttcctgtgtgtgagcaaatcttttgt
ccaagccctccatctatccttaatgggagccacaccggaactcctcagggagacgttccc
tatggagaggaaattacttatatgtgtgacccccgctcggccagagggatgaccttcaac
ctcgtcggggagagcaccatccgctgcacaagcgacggtgaagggaatgggatttggagc
ggccctgccccttactgtgaacctgctggtcctgctggttactgtaaagccccaaaacag
tttccatttgccaagcctgcaactcagactgatgaatctgagtttccagttgggacatct
ttgacttttaaatgttcccctgggtattttgagtctacgttttctatcacctgcttagaa
aacttggtctggtccagtgccgaagatacgtgtagacgaaaatcatgtggagctcctcca
gaacccttcaatggcatggtacatataaacacagacacccagtttggatcaacagtgaat
tattcttgtaatgaagggtatcgactcgttggctccccttctgcagcttgtcacctctca
ggcaatactgtcacttgggataaggaaacacctatttgtaagaaaatcttttgtccaagt
cctccatctatccctaatgggaactaccccagaacttctcagggagacgttccctatgga
gaggaagttacttacatgtgtgaaccccgctcggccagagggatgaccttcaacctcgtc
ggggagagcaccatccgctgcacgagcgatggtgaagggaacgggatttggagcggccct
gccccttcctgtgaacttgctggtcctgctgcatgcccacatccacccaagatccacaat
gggcattacattggagaacatccatttccatatcttcctgggatgacggtcagctacact
tgtgacccaggctacttgttggtgggaaggaacttcatcttctgcacatacctgggaacc
tggagtcattttgaacattattgcagagaggcaaaatgtagactcccagcgcatatgaat
ggaatccggaaggacgtggaaatgagaaaagtctatcaccatggagataatgtaactttt
gagtgcgaagaggggtatactctgaaaggtagtccccagagccagtgccaggcagataac
acgtgggaccctcctctggccatatgtgcatctagcacacacgatgctctcatagctggc
attttctttggcacgatcttctttcttttacccatcatcgtggccggttggataattgtg
aagcacaaacaaggcaaaacgacagatgaaaaatgtaaggagagtatccatttacaccct
caagaagacagcggtgtaagtcctcaaactgtgcaaaccaatcaggagaacagcagtgtc
cttccttga

DBGET integrated database retrieval system