KEGG   Felis catus (domestic cat): 102899861
Entry
102899861         CDS       T02385                                 
Symbol
CCL25
Name
(RefSeq) C-C motif chemokine 25
  KO
K13072  C-C motif chemokine 25
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102899861 (CCL25)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102899861 (CCL25)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    102899861 (CCL25)
   04062 Chemokine signaling pathway
    102899861 (CCL25)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    102899861 (CCL25)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   102899861 (CCL25)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 102899861
NCBI-ProteinID: XP_019672291
LinkDB
Position
A2:complement(5875141..5884111)
AA seq 166 aa
MQTVHPVKVPPADLPAPGGALSPSVIRHLGSRTSRCTMNLWLPLCLVVAASFVGIWCPVH
AQGVSEDCCLAYHRLESLDFLKRALGYQRQEVSGSCNLPAVIFFLRKHRMVCGNPRDKRV
KYWTEFLDARKAKHHRSRLRTPSGVSWPPRSNKTKTALRTTAHPDP
NT seq 501 nt   +upstreamnt  +downstreamnt
atgcagaccgtgcatcctgtgaaagtccccccggcggatctgccagccccaggaggggca
ctcagtccttccgtgatcagacacctggggagcaggaccagccggtgcacaatgaacttg
tggctcccgctgtgcctggtggtggcggccagctttgtgggcatctggtgtcctgtccac
gctcaaggtgtctcggaggactgttgcctagcctaccaccggctcgagagcctggacttt
ctgaagcgcgccctggggtaccagcgccaggaggtgagcggcagctgcaacctgccggct
gtgatattcttcttgcggaaacacaggatggtgtgtggcaacccccgggacaagagggtg
aagtactggacagaattcctggatgcgcggaaggcaaagcatcacagaagccgcctgaga
accccgtccggggttagctggccccccagaagcaacaagacgaaaactgccctccggacg
acggctcatccagatccgtga

DBGET integrated database retrieval system