KEGG   Felis catus (domestic cat): 102900229
Entry
102900229         CDS       T02385                                 

Symbol
MAF
Name
(RefSeq) transcription factor Maf
  KO
K09035  transcription factor Maf
Organism
fca  Felis catus (domestic cat)
Pathway
fca04658  Th1 and Th2 cell differentiation
fca05202  Transcriptional misregulation in cancer
fca05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102900229 (MAF)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102900229 (MAF)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102900229 (MAF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    102900229 (MAF)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Maf
    102900229 (MAF)
SSDB
Motif
Pfam: bZIP_Maf Maf_N ZapB bZIP_1 bZIP_2 KASH_CCD GAS NUDE_C vATP-synt_E
Other DBs
NCBI-GeneID: 102900229
NCBI-ProteinID: XP_023101135
LinkDB
Position
E2
AA seq 414 aa
MASELAMSNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLIAGGSLSSTPM
STPCSSVPPSPSFSAPSPGSGSEQKAHLEDYYWMTGYPQQLNPEALGFSPEDAVEALISN
SHQLQGGFDGYARGAQQLASAAGAGAGASLGGSGEEMGPAAAVVSAVIAAAAAQSGAGPH
YHHHHHHHAAGHGHHHHPTAGAPGAAGSASASAGGAGGAGGGGPASAGGGGGGGGGGGGG
GGGGGGGGGAAGAGGALHPHHAAGGLHFDDRFSDEQLVTMSVRELNRQLRGVSKEEVIRL
KQKRRTLKNRGYAQSCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYE
KLVSSGFRENGSSSDNPSSPEFFITEPTRELEPSVGYPTFWKAQQCVPASVFAK
NT seq 1245 nt   +upstreamnt  +downstreamnt
atggcatcagaactggcaatgagcaactccgacctgcccaccagtcccctggccatggaa
tatgttaatgacttcgatctgatgaagtttgaagtgaaaaaggaaccggtggagaccgac
cgcatcatcagccagtgcggccgtctcattgccgggggctcgctgtcctccacccccatg
agcacgccgtgcagctcggtgcccccttcccccagcttctcggcgcccagcccgggctcg
ggcagcgagcagaaggcgcacctggaagactactactggatgaccggctacccgcagcag
ctgaaccccgaggcgctgggcttcagccccgaggacgcggtcgaggcgctcatcagcaac
agccaccagctccagggcggcttcgatggctacgcgcgcggggcgcagcagctggcctcg
gcggccggggccggcgccggcgcctccctgggcggcagcggcgaggagatgggccccgcc
gccgccgtggtgtccgccgtgatcgccgcggccgccgcgcagagcggcgcgggcccgcat
taccaccaccaccaccaccaccacgccgccggccacggccaccaccaccacccgacggcc
ggcgcgcccggcgccgcgggcagcgcgtccgcctcggccggtggcgcgggcggcgcgggc
ggcggtggcccggccagcgccgggggcggcggcggaggcggcggcggaggcggcggcggc
ggcggcggcggcggcggcggcgggggcgcggcgggggcggggggcgccctgcacccgcac
cacgccgcgggcggcctgcacttcgacgaccgcttctccgacgagcagctggtgaccatg
tcggtgcgcgagctgaaccggcagctgcgcggggtcagcaaggaggaggtgatccggctg
aagcagaagaggcggaccctgaaaaaccgcggctatgcccagtcctgccgcttcaagagg
gtgcagcagagacacgtcctggagtccgagaagaatcagctgctgcagcaggtcgaccac
ctcaagcaggagatctccaggctggtgcgcgagagggacgcgtacaaggagaaatacgag
aagttggtgagcagcggcttccgagaaaacggctcgagcagcgacaacccgtcctctccc
gagtttttcataactgagcccactcgtgagttggagccatcagtgggataccccacgttt
tggaaggcccagcaatgcgtacctgccagtgtattcgcaaaatga

DBGET integrated database retrieval system