Felis catus (domestic cat): 102902220 Help Entry 102902220         CDS       T02385                                  Symbol DEFB1 Name (RefSeq) beta-defensin 1   KO K23125   beta-defensin 1 Organism fca  Felis catus (domestic cat) Pathway fca02010   ABC transporters fca05150   Staphylococcus aureus infection Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     102902220 (DEFB1)  09160 Human Diseases   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     102902220 (DEFB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:fca02000]     102902220 (DEFB1)    03037 Cilium and associated proteins [BR:fca03037]     102902220 (DEFB1) Transporters [BR:fca02000]  Other transporters   Pores ion channels [TC:1]    102902220 (DEFB1) Cilium and associated proteins [BR:fca03037]  Motile cilia and associated proteins   Sperm associated proteins    102902220 (DEFB1) SSDB OrthologParalogGFIT Motif Pfam:  Defensin_beta Defb50 Motif Other DBs NCBI-GeneID:  102902220 NCBI-ProteinID:  XP_006930602 LinkDB All DBs Position B1:complement(6791008..6803828) Genome browser AA seq 68 aa AA seqDB search MKALCFLLLALCLLSRLAPGAAFLTGLGQRSDHYICARKGGTCNFSPCPLFTRIDGTCYG GKAKCCMR NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaaggctctctgcttcctgctgctggcgctgtgcctcctctcccgcctggccccaggt gctgcctttctcacgggtctcggccagcggtctgaccactacatatgtgccaggaaagga ggaacctgtaacttttctccatgcccgctttttaccaggatcgatggcacctgctatggt ggaaaggccaagtgctgcatgcgctga

DBGET integrated database retrieval system