Felis catus (domestic cat): 105260537 Help Entry 105260537         CDS       T02385                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05202   Transcriptional misregulation in cancer fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105260537  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     105260537   09163 Immune disease    05322 Systemic lupus erythematosus     105260537   09165 Substance dependence    05034 Alcoholism     105260537  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     105260537   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     105260537 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105260537 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105260537 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone YebU_pre-PUA_dom Motif Other DBs NCBI-GeneID:  105260537 NCBI-ProteinID:  XP_011280373 LinkDB All DBs Position B2:complement(3268020..3269263) Genome browser AA seq 142 aa AA seqDB search MKFGAKKVAFPDLGGRRSEQPAPGGVKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRL VREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIRAKRVTVMPKGHAVRVQA NGELQGPIVVRHPKAGRHVHSS NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atgaaatttggcgcaaaaaaagttgccttccctgacttgggcggacggcgcagcgagcaa ccggcccccggcggcgtcaagccgcaccgctaccggcccggcacggtggccctgcgcgag atccgccgctaccagaagtccaccgagctgctgatccgcaagctgccgttccagcggctg gtgcgcgagatcgcgcaggacttcaagaccgacctgcgcttccagagctcggccgtgatg gcgctgcaggaggcgtgcgaggcctacctggtggggctcttcgaggacaccaacctgtgc gccatccgcgccaagcgcgtcaccgtcatgcccaaaggacatgcagttcgcgtacaggcg aacggagagcttcagggcccgattgtcgtgcgccatcccaaggctggccgccacgtccac tcttcctaa

DBGET integrated database retrieval system