Felis catus (domestic cat): 105260541 Help Entry 105260541         CDS       T02385                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05202   Transcriptional misregulation in cancer fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105260541  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     105260541   09163 Immune disease    05322 Systemic lupus erythematosus     105260541   09165 Substance dependence    05034 Alcoholism     105260541  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     105260541   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     105260541 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105260541 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105260541 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  105260541 NCBI-ProteinID:  XP_019687254 UniProt:  M3XAW8 LinkDB All DBs Position B2:complement(3670932..3672460) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcaccaagcagacggcgcgcaagtcgacgggcggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccaccggcggcgtcaagaagccgcac cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgcatccgcggcgagagggcgtaa

DBGET integrated database retrieval system