KEGG   Felis catus (domestic cat): 109491361
Entry
109491361         CDS       T02385                                 
Symbol
CLEC1B
Name
(RefSeq) C-type lectin domain family 1 member B
  KO
K10070  C-type lectin domain family 1 member B
Organism
fca  Felis catus (domestic cat)
Pathway
fca04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109491361 (CLEC1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:fca04054]
    109491361 (CLEC1B)
   04091 Lectins [BR:fca04091]
    109491361 (CLEC1B)
Pattern recognition receptors [BR:fca04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   109491361 (CLEC1B)
Lectins [BR:fca04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   109491361 (CLEC1B)
SSDB
Motif
Pfam: Lectin_C UL45 DUF3169 VirB8 LapA_dom
Other DBs
NCBI-GeneID: 109491361
NCBI-ProteinID: XP_003988447
LinkDB
Position
B4:46433031..46445498
AA seq 269 aa
MAPPYQREEDHRLTNTEIVKSGHCKFAKSLDPKLTRSPREAMQDEDGYVTLNIKGRKPAL
TSVDSASSPLWRVMALILLTLCVGLVIGLVALWMMSATERNYLQVENKNFSGTLHRLAQQ
FCQYIIKQSEQKSGVSHKCSPCDRNWRYYGDSCYGFFRHNLTWEESKQYCVNVNATLLKI
TSQKVLEYMKSRTGFIRWVGLSRKNTNEVWRWEDGSVPSKDVFELSGNGGDNMNCAYFYN
GKIYPTFCNDKHYLMCERKAGMTKVDTLL
NT seq 810 nt   +upstreamnt  +downstreamnt
atggctcctccttaccagagagaggaggatcatcgactcaccaacactgaaatcgtcaag
agtggacattgcaagtttgcaaagtcattggaccctaagctcactcgtagtccaagggaa
gccatgcaggatgaagacggatatgtcactttaaatattaaaggtcgaaaaccggctctc
acctcagttgactctgcttcctcacctttgtggcgtgtgatggctttgattctgctgacc
ttgtgcgtggggttagttattgggctggtggctttgtggatgatgtctgccacagagcga
aactacctacaagtggagaacaaaaatttctcaggcactctgcaccggttggcacagcag
ttctgccagtatataataaaacaatccgaacaaaagagcggcgtcagccataaatgcagc
ccatgtgaccgtaactggagatactacggcgatagttgctatggatttttcaggcacaac
ttgacgtgggaagagagtaaacagtactgtgttaacgtgaacgccactttgctgaagatc
accagccagaaagtcctggaatacatgaagtctaggactggattcattcgttgggttgga
ctgtcccgcaagaacactaatgaggtctggaggtgggaagatggttcagtgccctccaaa
gatgtgtttgagctttctggaaatggaggagacaatatgaattgtgcctatttttataat
gggaaaatttaccccaccttctgtaatgacaaacattacttaatgtgtgagaggaaggca
ggcatgacaaaggtggacacactcctgtaa

DBGET integrated database retrieval system