KEGG   Felis catus (domestic cat): 109498956
Entry
109498956         CDS       T02385                                 
Symbol
GYPA
Name
(RefSeq) glycophorin-A isoform X1
  KO
K06575  glycophorin A
Organism
fca  Felis catus (domestic cat)
Pathway
fca04640  Hematopoietic cell lineage
fca05144  Malaria
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109498956 (GYPA)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    109498956 (GYPA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    109498956 (GYPA)
CD molecules [BR:fca04090]
 Proteins
  109498956 (GYPA)
SSDB
Motif
Pfam: Glycophorin_A Alph_Pro_TM CYYR1
Other DBs
NCBI-GeneID: 109498956
NCBI-ProteinID: XP_019684476
UniProt: A0A337SD48
LinkDB
Position
B1:84907319..84944712
AA seq 123 aa
MYEKTIILTVLLLSGYSSSQLTTESVSMTHETPVRAMTVQSPRVVTTEALPFSIPGDGLL
EHIFSAGEITGIVYAVMAGIIGTILSIAFCIKRLTKKTPSPVQTAQPEDADPESSVETRN
PEQ
NT seq 372 nt   +upstreamnt  +downstreamnt
atgtatgaaaaaacaataatactaactgtattactactctcaggctatagttcctctcaa
ctaactactgaaagtgtctcaatgactcacgaaacaccagtaagggccatgactgttcaa
tcaccacgtgtggttaccacagaggccttaccattcagcattcctggagacggactactt
gaacacattttttctgcaggagagataacagggattgtgtatgcggtaatggctggtatc
atcggaactatcctctcaattgccttctgtattaaacgactaacaaagaaaactccatct
cctgtgcaaactgcacaaccagaggacgcagatcctgaaagttctgtagaaacaagaaat
ccagaacagtaa

DBGET integrated database retrieval system