KEGG   Felis catus (domestic cat): 111558242
Entry
111558242         CDS       T02385                                 
Symbol
SOCS1
Name
(RefSeq) suppressor of cytokine signaling 1
  KO
K04694  suppressor of cytokine signaling 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04120  Ubiquitin mediated proteolysis
fca04380  Osteoclast differentiation
fca04630  JAK-STAT signaling pathway
fca04910  Insulin signaling pathway
fca04917  Prolactin signaling pathway
fca04930  Type II diabetes mellitus
fca04935  Growth hormone synthesis, secretion and action
fca05145  Toxoplasmosis
fca05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111558242 (SOCS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111558242 (SOCS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111558242 (SOCS1)
   04917 Prolactin signaling pathway
    111558242 (SOCS1)
   04935 Growth hormone synthesis, secretion and action
    111558242 (SOCS1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111558242 (SOCS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111558242 (SOCS1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111558242 (SOCS1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111558242 (SOCS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:fca04121]
    111558242 (SOCS1)
Ubiquitin system [BR:fca04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     111558242 (SOCS1)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 111558242
NCBI-ProteinID: XP_023102353
LinkDB
Position
E3:35302576..35313054
AA seq 180 aa
MLQMKKLRLRAAPAPAPAPGDTHFRTFRSHAEYRRITRASALLDACGFYWGPLSVHGAHE
RLRAEPVGTFLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELL
EHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI
NT seq 543 nt   +upstreamnt  +downstreamnt
atgttacagatgaagaagctgagactcagagcggccccggccccggccccggcccccggc
gacacgcacttccgcacgttccgctctcacgccgagtaccggcgcatcacccgagccagc
gcgctgctcgacgcctgcggcttctactgggggcccctgagcgtgcacggggcgcacgaa
cggctgcgcgccgagcccgtgggcaccttcctggtgcgcgacagccgccagcggaactgc
ttcttcgccctcagcgtgaagatggcctcgggccccacgagcatccgcgtgcacttccag
gccggccgcttccacctggacggcagccgcgagagcttcgactgcctcttcgagctgctg
gagcactacgtggcggcgccgcgccgcatgctcggggccccgctgcgccagcgccgcgtg
cggccgctgcaggagctgtgtcgccagcgcatcgtggccaccgtgggccgcgagaacctg
gcgcgcatccccctcaaccctgtcctccgcgactacttgagctccttcccctttcagatc
tga

DBGET integrated database retrieval system