Felis catus (domestic cat): 111560806 Help Entry 111560806         CDS       T02385                                  Name (RefSeq) interleukin-3-like   KO K04736   interleukin 3 Organism fca  Felis catus (domestic cat) Pathway fca04060   Cytokine-cytokine receptor interaction fca04151   PI3K-Akt signaling pathway fca04210   Apoptosis fca04630   JAK-STAT signaling pathway fca04640   Hematopoietic cell lineage fca04664   Fc epsilon RI signaling pathway fca05200   Pathways in cancer fca05202   Transcriptional misregulation in cancer fca05221   Acute myeloid leukemia fca05310   Asthma Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     111560806    04151 PI3K-Akt signaling pathway     111560806   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     111560806  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     111560806  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     111560806    04664 Fc epsilon RI signaling pathway     111560806  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111560806    05202 Transcriptional misregulation in cancer     111560806   09162 Cancer: specific types    05221 Acute myeloid leukemia     111560806   09163 Immune disease    05310 Asthma     111560806  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:fca04052]     111560806    00536 Glycosaminoglycan binding proteins [BR:fca00536]     111560806 Cytokines and neuropeptides [BR:fca04052]  Cytokines   Interleukins    111560806 Glycosaminoglycan binding proteins [BR:fca00536]  Heparan sulfate / Heparin   Cytokines    111560806 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL3 AtzG-like Motif Other DBs NCBI-GeneID:  111560806 NCBI-ProteinID:  XP_023110932 LinkDB All DBs Position A1:108809857..108811698 Genome browser AA seq 143 aa AA seqDB search MSNLPIMYLLLLLLGFQAPQAQGRPFPTYQLNQYLAKIDEIMKILNKLPLPSQDPLDPNE TEILRENTLLRPNLDAFLKAAENFHEDGLLIWKNLKEFLPLLPTPTPRGDPIHIEEDNWV DFQWKLTKYLEILDNFLNFKEKH NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgagcaaccttcccatcatgtaccttctcctgcttcttcttggattccaagcgcctcag gcacaggggcggccctttccaacttaccagctgaaccaatacttggcaaagattgatgaa attatgaagatcttaaacaagttacccttgccttcacaggaccccttggacccaaatgag acagagatcctgagggaaaacacccttctgaggccaaacctggatgcattcttaaaagct gcagaaaatttccatgaagatggactgctaatctggaaaaatcttaaggaattcctgcca ctcctgcccactcccacacccaggggagacccaatccatatcgaggaggataactgggtt gatttccaatggaaactgactaaatatctggaaatccttgataactttctgaatttcaag gagaaacactga

DBGET integrated database retrieval system