Felis catus (domestic cat): 123381775 Help Entry 123381775         CDS       T02385                                  Name (RefSeq) interferon alpha-2-like   KO K05414   interferon alpha Organism fca  Felis catus (domestic cat) Pathway fca04060   Cytokine-cytokine receptor interaction fca04151   PI3K-Akt signaling pathway fca04217   Necroptosis fca04620   Toll-like receptor signaling pathway fca04621   NOD-like receptor signaling pathway fca04622   RIG-I-like receptor signaling pathway fca04623   Cytosolic DNA-sensing pathway fca04630   JAK-STAT signaling pathway fca04650   Natural killer cell mediated cytotoxicity fca04936   Alcoholic liver disease fca05152   Tuberculosis fca05160   Hepatitis C fca05161   Hepatitis B fca05162   Measles fca05163   Human cytomegalovirus infection fca05164   Influenza A fca05165   Human papillomavirus infection fca05167   Kaposi sarcoma-associated herpesvirus infection fca05168   Herpes simplex virus 1 infection fca05169   Epstein-Barr virus infection fca05170   Human immunodeficiency virus 1 infection fca05171   Coronavirus disease - COVID-19 fca05200   Pathways in cancer fca05320   Autoimmune thyroid disease fca05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     123381775    04151 PI3K-Akt signaling pathway     123381775   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123381775  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     123381775  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123381775    04621 NOD-like receptor signaling pathway     123381775    04622 RIG-I-like receptor signaling pathway     123381775    04623 Cytosolic DNA-sensing pathway     123381775    04650 Natural killer cell mediated cytotoxicity     123381775  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123381775   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     123381775    05161 Hepatitis B     123381775    05160 Hepatitis C     123381775    05171 Coronavirus disease - COVID-19     123381775    05164 Influenza A     123381775    05162 Measles     123381775    05168 Herpes simplex virus 1 infection     123381775    05163 Human cytomegalovirus infection     123381775    05167 Kaposi sarcoma-associated herpesvirus infection     123381775    05169 Epstein-Barr virus infection     123381775    05165 Human papillomavirus infection     123381775   09171 Infectious disease: bacterial    05152 Tuberculosis     123381775   09163 Immune disease    05320 Autoimmune thyroid disease     123381775   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123381775   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     123381775  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:fca04052]     123381775 Cytokines and neuropeptides [BR:fca04052]  Cytokines   Interferons    123381775 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon MRB1590_C Motif Other DBs NCBI-GeneID:  123381775 NCBI-ProteinID:  XP_044899623 LinkDB All DBs Position D4:complement(45624989..45625795) Genome browser AA seq 192 aa AA seqDB search MTSRSLPSWALMLLLSSTACSLDCHFQRRGIWEIVQHLENLGKKFPLRCLKDRSNFRFLQ VAKIDQLPEETAFPAIGEMLTQVFNTFNLNVSQSLWNESRLERLLSGLYQQTEKTGVCLE QDSGQEDHSSSQREGTRLAIKNYFQGIRDYLQGQKYSHCAWEVIRVEIRRCFLFIEQLTR RHRDQEIGHLHN NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgaccagccggagcttgccgagctgggctttgatgctacttctttccagtactgcctgc tctctggactgtcactttcaacggaggggcatctgggagattgtacaacatttagagaac cttggaaaaaaatttcccctgagatgtctgaaggacagaagcaacttcagattcctccag gttgcaaaaatcgaccagcttccggaggaaactgctttcccggccattggagaaatgctg acacaggtcttcaacactttcaacctgaatgtctcccaatcgttgtggaatgaaagccgt ttagagagactcctaagtggactgtatcagcaaacggagaagacaggggtatgcctggag caggactctgggcaggaggatcattcatcctcgcaaagggagggtaccagacttgcaata aagaattatttccaaggcatccgtgactatttgcaaggccaaaagtatagccactgtgcc tgggaggtcatccgtgtggaaatccgaaggtgttttctcttcattgaacagctgacaaga agacatcgggaccaagaaataggtcacttacataactaa

DBGET integrated database retrieval system