Felis catus (domestic cat): 493653 Help Entry 493653            CDS       T02385                                  Symbol IFNA7 Name (RefSeq) interferon alpha precursor   KO K05414   interferon alpha Organism fca  Felis catus (domestic cat) Pathway fca04060   Cytokine-cytokine receptor interaction fca04151   PI3K-Akt signaling pathway fca04217   Necroptosis fca04620   Toll-like receptor signaling pathway fca04621   NOD-like receptor signaling pathway fca04622   RIG-I-like receptor signaling pathway fca04623   Cytosolic DNA-sensing pathway fca04630   JAK-STAT signaling pathway fca04650   Natural killer cell mediated cytotoxicity fca04936   Alcoholic liver disease fca05152   Tuberculosis fca05160   Hepatitis C fca05161   Hepatitis B fca05162   Measles fca05163   Human cytomegalovirus infection fca05164   Influenza A fca05165   Human papillomavirus infection fca05167   Kaposi sarcoma-associated herpesvirus infection fca05168   Herpes simplex virus 1 infection fca05169   Epstein-Barr virus infection fca05170   Human immunodeficiency virus 1 infection fca05171   Coronavirus disease - COVID-19 fca05200   Pathways in cancer fca05320   Autoimmune thyroid disease fca05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     493653 (IFNA7)    04151 PI3K-Akt signaling pathway     493653 (IFNA7)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     493653 (IFNA7)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     493653 (IFNA7)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     493653 (IFNA7)    04621 NOD-like receptor signaling pathway     493653 (IFNA7)    04622 RIG-I-like receptor signaling pathway     493653 (IFNA7)    04623 Cytosolic DNA-sensing pathway     493653 (IFNA7)    04650 Natural killer cell mediated cytotoxicity     493653 (IFNA7)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     493653 (IFNA7)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     493653 (IFNA7)    05161 Hepatitis B     493653 (IFNA7)    05160 Hepatitis C     493653 (IFNA7)    05171 Coronavirus disease - COVID-19     493653 (IFNA7)    05164 Influenza A     493653 (IFNA7)    05162 Measles     493653 (IFNA7)    05168 Herpes simplex virus 1 infection     493653 (IFNA7)    05163 Human cytomegalovirus infection     493653 (IFNA7)    05167 Kaposi sarcoma-associated herpesvirus infection     493653 (IFNA7)    05169 Epstein-Barr virus infection     493653 (IFNA7)    05165 Human papillomavirus infection     493653 (IFNA7)   09171 Infectious disease: bacterial    05152 Tuberculosis     493653 (IFNA7)   09163 Immune disease    05320 Autoimmune thyroid disease     493653 (IFNA7)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     493653 (IFNA7)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     493653 (IFNA7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:fca04052]     493653 (IFNA7) Cytokines and neuropeptides [BR:fca04052]  Cytokines   Interferons    493653 (IFNA7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  493653 NCBI-ProteinID:  NP_001009197 Ensembl:  ENSFCAG00000046651 UniProt:  P35849 A0A7R8C522 LinkDB All DBs Position D4:45809663..45810409 Genome browser AA seq 194 aa AA seqDB search MALPSSFLVALVALGCNSVCVLGCDLPQTHGLLNRRALTLLGQMRRLPASSCQKDRNDFA FPQDVFGGDQSHKAQALSVVHVTNQKIFHFFCTEASSSAAWNTTLLEEFCTGLDRQLTRL EACVLQEVEEGEAPLTNEDIHPEDSILRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLY YSSTALQKRLRSEK NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atggcgctgccctcttccttcttggtggccctggtggcgctgggctgcaactccgtctgc gtgctgggctgtgacctgcctcagacccacggcctgctgaacaggagggccttgacgctc ctgggacaaatgaggagactccctgccagctcctgtcagaaggacagaaatgacttcgcc ttcccccaggacgtgttcggtggagaccagtcccacaaggcccaagccctctcggtggtg cacgtgacgaaccagaagatcttccacttcttctgcacagaggcgtcctcgtctgctgct tggaacaccaccctcctggaggaattttgcacgggacttgatcggcagctgacccgcctg gaagcctgtgtcctgcaggaggtggaggagggagaggctcccctgacgaacgaggacatt catcccgaggactccatcctgaggaactacttccaaagactctccctctacctgcaagag aagaaatacagcccttgtgcctgggagatcgtcagagcagaaatcatgagatccttgtat tattcatcaacagccttgcagaaaagattaaggagcgagaaatga

DBGET integrated database retrieval system