Felis catus (domestic cat): 493668 Help Entry 493668            CDS       T02385                                  Symbol CAV1 Name (RefSeq) caveolin-1   KO K06278   caveolin 1 Organism fca  Felis catus (domestic cat) Pathway fca04144   Endocytosis fca04510   Focal adhesion fca05020   Prion disease fca05100   Bacterial invasion of epithelial cells fca05205   Proteoglycans in cancer fca05416   Viral myocarditis fca05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     493668 (CAV1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     493668 (CAV1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     493668 (CAV1)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     493668 (CAV1)   09164 Neurodegenerative disease    05020 Prion disease     493668 (CAV1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     493668 (CAV1)    05416 Viral myocarditis     493668 (CAV1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fca04131]     493668 (CAV1) Membrane trafficking [BR:fca04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     493668 (CAV1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  493668 NCBI-ProteinID:  NP_001019334 UniProt:  A0M8S7 LinkDB All DBs Position A2:134814361..134849359 Genome browser AA seq 178 aa AA seqDB search MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMAEEINEKQVYDAHTKEIDLVNRDPKHLN DDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFA ILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPFFEAVGKIFSNIRINMQKEI NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgtctgggggcaaatacgtagactccgagggacatctctacactgttcccatccgggaa cagggcaatatctacaagcccaacaacaaggccatggcagaagagattaacgagaagcaa gtgtacgacgcgcacacgaaggagatcgacttggtcaaccgcgatcccaagcatctcaat gacgacgttgtcaagattgattttgaagacgtgattgcagaaccagaaggaacacacagt tttgatggcatctggaaggccagcttcaccaccttcactgtgacaaaatactggttttac cgcttgctgtctgccctctttggcatcccaatggcgcttatctggggcatttactttgcc attctttctttcctgcacatctgggcagttgtaccgtgcattaagagtttcctgattgag attcagtgcatcagccgtgtctattccatctacgtccacaccttctgtgacccgttcttt gaggctgttggcaaaatattcagcaatattcgcatcaatatgcagaaagaaatataa

DBGET integrated database retrieval system