KEGG   Felis catus (domestic cat): 493669
Entry
493669            CDS       T02385                                 
Symbol
MET
Name
(RefSeq) hepatocyte growth factor receptor precursor
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04360  Axon guidance
fca04510  Focal adhesion
fca04520  Adherens junction
fca05100  Bacterial invasion of epithelial cells
fca05144  Malaria
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05211  Renal cell carcinoma
fca05218  Melanoma
fca05223  Non-small cell lung cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    493669 (MET)
   04014 Ras signaling pathway
    493669 (MET)
   04015 Rap1 signaling pathway
    493669 (MET)
   04020 Calcium signaling pathway
    493669 (MET)
   04151 PI3K-Akt signaling pathway
    493669 (MET)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    493669 (MET)
   04520 Adherens junction
    493669 (MET)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    493669 (MET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493669 (MET)
   05202 Transcriptional misregulation in cancer
    493669 (MET)
   05206 MicroRNAs in cancer
    493669 (MET)
   05205 Proteoglycans in cancer
    493669 (MET)
   05208 Chemical carcinogenesis - reactive oxygen species
    493669 (MET)
   05230 Central carbon metabolism in cancer
    493669 (MET)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    493669 (MET)
   05226 Gastric cancer
    493669 (MET)
   05218 Melanoma
    493669 (MET)
   05211 Renal cell carcinoma
    493669 (MET)
   05223 Non-small cell lung cancer
    493669 (MET)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    493669 (MET)
  09174 Infectious disease: parasitic
   05144 Malaria
    493669 (MET)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    493669 (MET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    493669 (MET)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     493669 (MET)
Protein kinases [BR:fca01001]
 Receptor tyrosine kinases (RTK)
  MET family
   493669 (MET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TIG Sema PSI Pkinase_fungal Kinase-like Linker_histone Ninjurin
Other DBs
NCBI-GeneID: 493669
NCBI-ProteinID: NP_001162167
Ensembl: ENSFCAG00000009534
UniProt: A0M8S8
LinkDB
Position
A2:136661904..136780627
AA seq 1382 aa
MKAPAVLAPGILVLLFTLVQKSYGECREALVKSEMNVNMKYQLPNFTAETPIQNVVLHKH
HIYLGAVNYIYVLNDKDLQKVAEYKTGPVLEHPDCFPCQDCSHKANLSGGVWKDNINMAL
LIDTYYDDQLISCGSVHRGTCQRHVLPPSNTADILSKVHCMYSPQADEESSHCPDCVVSA
LGTKVLISEKGRFINFFVGNTINSSYLTDHSLHSISVRRLKETQDGFKFLTDQSYIDVLP
EFRDSYPIKYIHAFESNRFIYFLTVQRETLDAQTFHTRIIRFCSVDSGLHSYMEMPLECI
LTEKRRKRSTREEVFNILQAAYVSKPGAHLAKQIGANLNDDILYGVFAQSKPDSAEPMNR
SAVCAFPIKYVNEFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEVRSDEYRTE
FTTALQRVDLFMGQFNQVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGSSTPHVNF
RLDSHPVSSEAIVEHPLNQNGYTLVVTGKKITKIPLNGLGCEHFQSCSQCLSAPPFVQCG
WCHDKCVQLEECPSGTWTQEICLPTIYEVFPTSAPLEGGTMLTVCGWDFGFRRNNKFDLK
KTRVFLGNESCTLTLSESTTNMLKCTVGPAVNEHFNISIIISNGRGTAQYSTFSYVDPVI
TSIFPSYGPKTGGTLLTLTGKYLNSGNSRHISIGGKTCTLKSVSDSILECYTPAQTIPTE
FPIKLKIDLANREMNSFSYQEDPIVYAIHPTKSFISGGSTITAVGKNLNSVSVLRMVISV
HETRRNFTVACHHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGIHSKYFDLIYVHNP
VFKPFEKPVMISIGNENVLEIKGNDIDPEAVKGEVLKVGNKSCETIYSDSEAVLCKVPND
LLKLNNELNIEWKQAVSSTILGKVIVQPDQNFTGLIVGVISISIILLLLLGVFLWLKKRK
QIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNG
SCRQVQYPLTDLSPMLNSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVH
FNEVIGRGHFGCVYHGTLLDSDDKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNV
LSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKK
FVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQK
FTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKC
WHPKAELRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSQDNIDGEG
DT
NT seq 4149 nt   +upstreamnt  +downstreamnt
atgaaggcccctgctgtgcttgcacctggcatccttgtgcttctgtttaccttggtgcag
aagagctacggggagtgcagagaggcactagtaaagtctgagatgaatgtgaacatgaag
tatcagcttcccaacttcactgcagaaacacccatccagaatgttgttttacacaagcat
catatttaccttggtgcagttaactatatttacgttttaaatgacaaagaccttcagaag
gttgctgagtacaagactgggcccgtgctggaacacccagattgtttcccatgtcaggac
tgcagccacaaagccaatttatcaggtggtgtttggaaagataacatcaacatggctcta
cttattgacacgtactatgacgaccaactcattagctgtggcagtgtccacagagggacc
tgccagcgacatgtccttccacccagcaatactgctgacatactgtcaaaagttcattgc
atgtactccccacaggcagacgaagagtccagccactgtcctgactgtgtggtgagtgcc
ctgggaaccaaagtcctgatatctgaaaagggccggttcatcaacttcttcgtgggcaat
accataaattcctcttacctaacagatcattcattgcattcaatatcagtgagaaggcta
aaggaaactcaagatggctttaagtttttaacagaccagtcttatattgatgttctccct
gaattcagagattcctaccctattaaatacatccatgcctttgaaagcaaccgttttatt
tactttttgacagtccagcgagaaactctagatgctcagacttttcacacaagaataatc
aggttctgttctgtagactctggattgcattcctacatggaaatgcctctggaatgtatc
ctcacagaaaagagaagaaagagatccacaagggaggaagtgtttaatattctccaagct
gcatatgtcagtaagcctggggcccaccttgctaagcaaataggtgccaacctgaatgat
gacattctctatggagtattcgcacaaagcaagccggattctgctgaaccaatgaatcgc
tctgccgtctgtgcattccctatcaaatatgtcaatgaattcttcaacaagattgtaaac
aaaaacaacgtgagatgtcttcaacatttttatggacccaaccacgaacactgctttaat
aggacacttttgagaaattcatcaggctgtgaagtgcgcagtgatgaatatcgaacggag
tttaccacagctttgcagcgagttgacttattcatgggccaattcaaccaagtcctctta
acatctatatccaccttcattaaaggagacctcaccattgctaatcttgggacatcagag
ggtcgctttatgcaggttgtggtttctcgatcaggatcatcaacacctcatgtgaatttt
cgcctggattcccaccctgtgtcttcagaagcaattgtggagcacccattaaaccaaaat
ggctacacactggttgttactggaaagaagatcaccaagatcccactgaatggcttaggc
tgtgaacatttccagtcctgcagtcagtgtctttctgcccctccctttgtgcagtgtggc
tggtgccacgataaatgtgtgcaactggaggaatgccccagtggaacatggactcaagag
atctgtctgcctacaatctatgaggttttcccaaccagtgcacccctggaaggaggaacg
atgctcactgtgtgtggctgggactttggattcaggaggaataataaatttgatttaaag
aaaactagagttttccttggaaatgagagctgcactttgaccttaagtgagagcacaaca
aatatgttgaaatgcacagttggtcctgcagtgaatgagcatttcaatatatccataatt
atttcaaatgggcgagggacagcacaatacagtacattttcctatgtggatcctgtaata
acaagtatttttccaagttatggtcctaagaccggtggcaccttgcttactttaactgga
aagtaccttaacagtgggaattctagacacatttcaattggtggaaaaacgtgtacttta
aaaagtgtgtcagatagtattctcgaatgttataccccagctcaaaccattccaactgag
tttcctattaaattgaaaattgacttagccaaccgagagatgaacagtttcagttaccag
gaagaccccattgtctatgcaattcatccaaccaaatcttttattagtggtgggagcacc
ataacagctgttgggaaaaacctgaattcagttagtgtcctaaggatggtaataagtgta
catgaaacaagaaggaactttacagtggcatgtcaccatcgctctaattcagagataatc
tgctgtacaactccttcactgcaacagctgaatctgcaactccctctgaaaaccaaagcc
tttttcatgttagatgggatccattccaaatactttgatctcatttatgtacataatcct
gtgtttaagccttttgaaaagccagtgatgatctcaataggcaatgaaaatgtactggaa
attaagggaaatgatattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaat
aagagctgtgagactatatactcagattctgaagctgttttatgcaaggtccccaatgac
ctgctgaaattgaacaacgagctaaatatagagtggaagcaagcagtttcttcaaccatc
cttggaaaagtaatagttcaaccagatcagaatttcacaggattgattgttggtgttatc
tcaatatcaataatactcttactattacttggggttttcctgtggctgaaaaagagaaag
caaattaaagatctgggcagtgaattagttcgctatgatgcaagagtacacactcctcat
ttggataggcttgtaagtgcccgaagtgtaagcccaactacagaaatggtttcaaatgaa
tctgtagactaccgagctacttttccagaagaccagtttcctaactcatctcagaatgga
tcatgcagacaagtacagtatcctctgacggacctgtcccccatgcttaatagtggggac
tctgatatatccagtccattactgcaaaatactgtccacattgacctcagtgctctaaat
ccagagctggtccaggcagtccagcacgtagtgattgggccaagtagcctgattgtgcat
ttcaatgaagtcataggaagaggacattttgggtgtgtgtaccatgggactttattggac
agcgatgacaagaagattcactgtgctgtgaaatccttgaatagaatcactgacataggt
gaagtttcccagtttctgactgagggaatcatcatgaaagattttagtcatccaaatgtt
ctctcactcttgggaatctgccttcgaagtgaggggtctccactggtggtcctaccatat
atgaaacatggagatcttcgaaatttcatcagaaatgagactcataacccaactgtaaaa
gatcttattggctttggtcttcaagtagccaaaggcatgaaatatcttgcaagcaaaaag
tttgtacacagagacttggctgctagaaactgtatgttggatgaaaaattcactgtcaag
gttgctgattttggtctggccagagacatgtatgataaagaatactacagtgtacacaac
aaaacgggcgccaagctgccagtgaagtggatggctctagaaagtctacaaactcagaag
tttaccaccaagtcagatgtgtggtcctttggtgtgctcctctgggaactgatgacaaga
ggggctccaccttatcctgatgtcaacacctttgatataacagtttacttattgcaaggc
agaagactcttacagcccgaatactgcccagatcccttatatgaagtgatgctaaaatgc
tggcaccctaaagctgaactgcgcccatctttttctgaactggtctccaggatatcagcg
atattctctactttcattggggagcactatgtccatgtgaacgctacttatgtgaatgtc
aaatgtgttgctccatacccttctctgttgtcatcacaagataacattgatggcgagggg
gacacatga

DBGET integrated database retrieval system