Felis catus (domestic cat): 493689 Help Entry 493689            CDS       T02385                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5 precursor   KO K12499   C-C motif chemokine 5 Organism fca  Felis catus (domestic cat) Pathway fca04060   Cytokine-cytokine receptor interaction fca04061   Viral protein interaction with cytokine and cytokine receptor fca04062   Chemokine signaling pathway fca04620   Toll-like receptor signaling pathway fca04621   NOD-like receptor signaling pathway fca04623   Cytosolic DNA-sensing pathway fca04668   TNF signaling pathway fca05020   Prion disease fca05142   Chagas disease fca05163   Human cytomegalovirus infection fca05164   Influenza A fca05168   Herpes simplex virus 1 infection fca05323   Rheumatoid arthritis fca05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     493689 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     493689 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     493689 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     493689 (CCL5)    04621 NOD-like receptor signaling pathway     493689 (CCL5)    04623 Cytosolic DNA-sensing pathway     493689 (CCL5)    04062 Chemokine signaling pathway     493689 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     493689 (CCL5)    05168 Herpes simplex virus 1 infection     493689 (CCL5)    05163 Human cytomegalovirus infection     493689 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     493689 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     493689 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     493689 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     493689 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:fca04052]     493689 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:fca00536]     493689 (CCL5) Cytokines and neuropeptides [BR:fca04052]  Cytokines   Chemokines    493689 (CCL5) Glycosaminoglycan binding proteins [BR:fca00536]  Heparan sulfate / Heparin   Chemokines    493689 (CCL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  493689 NCBI-ProteinID:  NP_001009827 Ensembl:  ENSFCAG00000001259 UniProt:  Q8SQ40 LinkDB All DBs Position E1:complement(23211786..23218728) Genome browser AA seq 92 aa AA seqDB search MKVSTAAFAVLLTAAAFCTPASASPYASDTTPCCFAYLSHPLPLTHLQEYFYTSSKCSMP AVVFVTRRKRQVCANPQKKWVRDKGINSLEMN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccacagctgcctttgcagtcctcctcactgctgccgctttctgcactcct gcctctgcatccccatatgcctcggacaccaccccctgctgctttgcctacctctcccac ccactgccgctcacccacctccaggagtatttctacaccagcagcaagtgttccatgcca gcagtcgtctttgtcacccggaggaagcgccaggtgtgtgccaacccacagaagaaatgg gtgcgggacaagggcatcaactctttggagatgaactag

DBGET integrated database retrieval system