KEGG   Felis catus (domestic cat): 493698
Entry
493698            CDS       T02385                                 
Symbol
TLR4
Name
(RefSeq) toll-like receptor 4 precursor
  KO
K10160  toll-like receptor 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca04064  NF-kappa B signaling pathway
fca04066  HIF-1 signaling pathway
fca04145  Phagosome
fca04151  PI3K-Akt signaling pathway
fca04217  Necroptosis
fca04613  Neutrophil extracellular trap formation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04936  Alcoholic liver disease
fca05132  Salmonella infection
fca05133  Pertussis
fca05134  Legionellosis
fca05135  Yersinia infection
fca05140  Leishmaniasis
fca05142  Chagas disease
fca05144  Malaria
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05152  Tuberculosis
fca05161  Hepatitis B
fca05162  Measles
fca05164  Influenza A
fca05170  Human immunodeficiency virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05205  Proteoglycans in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05321  Inflammatory bowel disease
fca05323  Rheumatoid arthritis
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    493698 (TLR4)
   04066 HIF-1 signaling pathway
    493698 (TLR4)
   04151 PI3K-Akt signaling pathway
    493698 (TLR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    493698 (TLR4)
  09143 Cell growth and death
   04217 Necroptosis
    493698 (TLR4)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    493698 (TLR4)
   04620 Toll-like receptor signaling pathway
    493698 (TLR4)
   04621 NOD-like receptor signaling pathway
    493698 (TLR4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    493698 (TLR4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    493698 (TLR4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    493698 (TLR4)
   05161 Hepatitis B
    493698 (TLR4)
   05171 Coronavirus disease - COVID-19
    493698 (TLR4)
   05164 Influenza A
    493698 (TLR4)
   05162 Measles
    493698 (TLR4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    493698 (TLR4)
   05135 Yersinia infection
    493698 (TLR4)
   05133 Pertussis
    493698 (TLR4)
   05134 Legionellosis
    493698 (TLR4)
   05152 Tuberculosis
    493698 (TLR4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    493698 (TLR4)
   05144 Malaria
    493698 (TLR4)
   05145 Toxoplasmosis
    493698 (TLR4)
   05140 Leishmaniasis
    493698 (TLR4)
   05142 Chagas disease
    493698 (TLR4)
  09163 Immune disease
   05323 Rheumatoid arthritis
    493698 (TLR4)
   05321 Inflammatory bowel disease
    493698 (TLR4)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    493698 (TLR4)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    493698 (TLR4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    493698 (TLR4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:fca04054]
    493698 (TLR4)
   04090 CD molecules [BR:fca04090]
    493698 (TLR4)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    493698 (TLR4)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    493698 (TLR4)
Pattern recognition receptors [BR:fca04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   493698 (TLR4)
CD molecules [BR:fca04090]
 Proteins
  493698 (TLR4)
Glycosaminoglycan binding proteins [BR:fca00536]
 Hyaluronan
  Cell surface receptors
   493698 (TLR4)
SSDB
Motif
Pfam: LRR_8 LRR_4 TIR LRR_1 TIR_2 LRR_5 LRR_9 DUF1863 Curto_V2
Other DBs
NCBI-GeneID: 493698
NCBI-ProteinID: NP_001009223
Ensembl: ENSFCAG00000024741
UniProt: P58727
LinkDB
Position
D4:79270745..79281675
AA seq 833 aa
MMPPTRLAGTLIPAMAFLSCLRPESWDPCVEVVPNITYQCMDLNLHKIPDNIPSSTKDLD
MSFNPLRNLGSHSFSNFPELQVLDLSRCEIQIIEDDAYQGLNHLSILILTGNPIQRLFPG
AFSGLSSLQTLVAVETNIASLEDFPIGHLKTLKELNVAHNLIHSFKLPEYFSNMSNLEYL
DLSNNKIQNIYHKDLQVLHQKPLLNLSLDLSLNPLDFIQPGAFKEVKLRELTLRSNFNST
DVMKASIQGLAGLQIHQLVLGEFKNERNLGRFDKSILEGLCNLIIEKFRIAYFDKFSEDA
IDSFNCLANVSTISLVHLYFKGLKQLPKNLGWQRLELVNCEFEQFPTWKLDPLKELVFSA
NEVRNAFTQVKLESLEFLDLSRNDFSLKSCCSERDLGTTRLKHLDLSFNNIITISSNFLG
LEQLEYLDFQHSSLKQVSDFSVFLPLKNLRYLDISYTHTQVAFHGIFNGLISLQILKMAG
NSFQDNFLPNIFMELTNLTILDLSDCQLEQVSQVAFNSLPKLQLLNMSHNHLLSLDTLPY
EPLHSLQTLDCSFNRIVASKEQELRHFPSNLSSLNLTRNDFACVCEHQSFLQWVKDQRQL
LVEVEQMVCAKPLDMQGMPMLNFRNATCQVRKTIITGSVFTVLLVFLVVVLVYKFYFHLM
LLAGCKKYSRGESTYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIA
ANIIQEGFHKSRKVIVVVSQHFIQSRWCIFEYGIAQTWQFLSSRAGIIFIVLQKLEKSLL
RQQVELYRLLNRNTYLEWEDSVLGRHIFWRRLRKALLDGKPRCPEGMADAEGS
NT seq 2502 nt   +upstreamnt  +downstreamnt
atgatgcctcctacccgcctggctgggactctgatcccagccatggccttcctctcctgc
ctgagacctgagagctgggacccttgtgtggaggtggttcctaacattacttaccaatgc
atggacctgaatcttcacaaaatccccgacaacatcccctcatcaaccaaggacctggac
atgagctttaaccccctgagaaatttaggcagccatagtttctccaacttcccagaactg
caggtgctggatttatccaggtgtgaaattcaaataattgaagatgatgcatatcagggc
ctaaaccacctctccatcttgatattgacaggaaatcctatccagaggttattcccagga
gctttttctggactatcaagtttacagacgctggtggctgtggagacaaacatagcatct
ctagaggacttccccattggacatctcaaaacgttgaaggagcttaatgtggctcacaat
cttatccattccttcaaattacctgaatatttttctaacatgtccaaccttgagtatttg
gatctttccaataacaagattcaaaatatttatcataaagacttacaggttctacatcaa
aagcctctactcaacctttctttagacttgtccctcaaccctttagactttatccaacca
ggtgcctttaaagaagttaagctccgtgaactgactttgagaagtaattttaatagtaca
gatgtaatgaaagcttctattcaaggtctggcaggtttacagatccatcagttggttctg
ggagaatttaaaaatgaaaggaacttgggaagatttgacaaatctatcctggagggactg
tgcaatttgatcatagaaaaattccggatagcatactttgacaagttctcagaggatgct
attgactcatttaattgtttggcaaacgtttctaccatttctctggtgcatctgtatttc
aaggggctaaaacagctccctaaaaatctcggatggcaacggttagaattggttaactgt
gaatttgaacaatttcccacatggaagctggaccctctcaaggagcttgttttctccgcc
aacgaagttaggaacgcttttactcaggttaagttggaaagccttgagtttctagacctc
agtagaaatgactttagtttgaagagttgctgttctgagagagatttggggacaaccaga
ctgaagcatttagatctaagcttcaacaatattattaccataagttcaaacttcttgggc
ttagaacagttagaatatctagacttccagcattccagtttgaaacaggtcagtgatttt
tcagtattcctacccctcaaaaacctccgttaccttgatatttcttacactcatacccaa
gttgccttccatggcatcttcaatggcttgatcagcctccaaatcttaaaaatggctggc
aattctttccaggacaacttccttccaaatattttcatggagctgactaacttgaccatt
ctagacctctctgattgtcagctggaacaggtgtcccaagtggcatttaactcactccct
aaacttcagttgctaaatatgagtcacaaccacctcttatcattggatacacttccttat
gaacctcttcactccctccagactctggactgcagttttaatcgtatagtggcctctaag
gagcaagaactacggcattttccaagtaatctatcttccttaaatcttactcggaatgat
tttgcttgtgtttgtgaacaccagagtttcctgcagtgggtcaaggaccagaggcagctc
ttggtggaagttgaacagatggtgtgtgcaaaacctttggacatgcagggcatgcccatg
ctgaattttaggaatgctacctgtcaggtgagaaagaccatcattactgggtcggttttc
actgtactcttggtttttctggtggtggttctggtgtataagttctatttccacctgatg
cttcttgctggctgtaaaaagtatagcagaggtgaaagcacctatgatgccttcgttatc
tactcaagccaggatgaagattgggtgaggaatgaattggtaaagaacttggaggagggg
gtgcccccttttcagctctgccttcactacagagactttattcctggtgtggccatcgcc
gccaacatcatccaggaaggtttccataaaagccggaaagttatcgtcgtggtgtcccag
cactttatccagagtcgatggtgcatctttgagtatgggattgcccagacttggcagttt
ctcagcagccgtgccggcatcatcttcatcgtcctgcagaagttggagaagtccctgctg
cggcagcaggtggagctgtatcgccttctcaacaggaacacctacctggagtgggaggac
agtgtcctggggaggcacatcttctggagacgactcagaaaagccttgctggacggtaaa
ccacgctgtccagaaggaatggcagatgcagaaggcagctag

DBGET integrated database retrieval system