KEGG   Felis catus (domestic cat): 493700
Entry
493700            CDS       T02385                                 
Symbol
CSF3
Name
(RefSeq) granulocyte colony-stimulating factor precursor
  KO
K05423  granulocyte colony-stimulating factor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
fca04657  IL-17 signaling pathway
fca05144  Malaria
fca05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    493700 (CSF3)
   04151 PI3K-Akt signaling pathway
    493700 (CSF3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493700 (CSF3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    493700 (CSF3)
   04657 IL-17 signaling pathway
    493700 (CSF3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    493700 (CSF3)
  09174 Infectious disease: parasitic
   05144 Malaria
    493700 (CSF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493700 (CSF3)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  CSF and other factors
   493700 (CSF3)
SSDB
Motif
Pfam: GCSF IL11 IL6
Other DBs
NCBI-GeneID: 493700
NCBI-ProteinID: NP_001009227
Ensembl: ENSFCAG00000014992
UniProt: Q9GJU0
LinkDB
Position
E1:41032042..41036260
AA seq 195 aa
MKLTALQLLLWHSALWMVQEATPLGPTSSLPQSFLLKCLEQVRKVQADGTALQERLCAAH
KLCHPEELVLLGHALGIPQAPLSSCSSQALQLTGCLRQLHSGLFLYQGLLQALAGISPEL
APTLDMLQLDITDFAINIWQQMEDVGMAPAVPPTQGTMPTFTSAFQRRAGGTLVASNLQS
FLEVAYRALRHFTKP
NT seq 588 nt   +upstreamnt  +downstreamnt
atgaagctgaccgccctgcagctgctgctgtggcacagcgcactctggatggtgcaagaa
gccacccccttgggccctaccagctccctgccccagagcttcctgctcaagtgcttagaa
caagtgaggaaggtccaggctgatggcacagcgctgcaggagaggctgtgcgccgcccac
aagctgtgccaccctgaggagctggtgctgcttgggcacgctctgggcatcccccaggct
cccctgagcagctgctccagccaggccctgcagctgacgggctgcctgcgtcaactccac
agtggcctcttcctctaccagggcctcctgcaggccctggcagggatatcccccgagtta
gcccccaccctggacatgctgcagctggacatcaccgactttgctatcaacatctggcag
cagatggaagacgtggggatggcccctgcagtgccgcccacccagggcaccatgccaacc
ttcacctcggccttccagcgccgggcaggaggcaccctggttgcctccaacctgcagagc
ttcctggaggtggcataccgtgctctgcgccacttcaccaagccctga

DBGET integrated database retrieval system