Felis catus (domestic cat): 493701 Help Entry 493701            CDS       T02385                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism fca  Felis catus (domestic cat) Pathway fca01521   EGFR tyrosine kinase inhibitor resistance fca01524   Platinum drug resistance fca04014   Ras signaling pathway fca04064   NF-kappa B signaling pathway fca04115   p53 signaling pathway fca04137   Mitophagy - animal fca04140   Autophagy - animal fca04151   PI3K-Akt signaling pathway fca04210   Apoptosis fca04215   Apoptosis - multiple species fca04621   NOD-like receptor signaling pathway fca04630   JAK-STAT signaling pathway fca05012   Parkinson disease fca05014   Amyotrophic lateral sclerosis fca05022   Pathways of neurodegeneration - multiple diseases fca05145   Toxoplasmosis fca05162   Measles fca05166   Human T-cell leukemia virus 1 infection fca05168   Herpes simplex virus 1 infection fca05170   Human immunodeficiency virus 1 infection fca05200   Pathways in cancer fca05202   Transcriptional misregulation in cancer fca05212   Pancreatic cancer fca05220   Chronic myeloid leukemia fca05222   Small cell lung cancer fca05225   Hepatocellular carcinoma fca05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     493701 (BCL2L1)    04630 JAK-STAT signaling pathway     493701 (BCL2L1)    04064 NF-kappa B signaling pathway     493701 (BCL2L1)    04151 PI3K-Akt signaling pathway     493701 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     493701 (BCL2L1)    04137 Mitophagy - animal     493701 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     493701 (BCL2L1)    04215 Apoptosis - multiple species     493701 (BCL2L1)    04115 p53 signaling pathway     493701 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     493701 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     493701 (BCL2L1)    05202 Transcriptional misregulation in cancer     493701 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     493701 (BCL2L1)    05225 Hepatocellular carcinoma     493701 (BCL2L1)    05220 Chronic myeloid leukemia     493701 (BCL2L1)    05222 Small cell lung cancer     493701 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     493701 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     493701 (BCL2L1)    05162 Measles     493701 (BCL2L1)    05168 Herpes simplex virus 1 infection     493701 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     493701 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     493701 (BCL2L1)    05014 Amyotrophic lateral sclerosis     493701 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     493701 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     493701 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     493701 (BCL2L1)    01524 Platinum drug resistance     493701 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:fca01009]     493701 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     493701 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:fca02000]     493701 (BCL2L1) Protein phosphatases and associated proteins [BR:fca01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      493701 (BCL2L1) Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     493701 (BCL2L1) Transporters [BR:fca02000]  Other transporters   Pores ion channels [TC:1]    493701 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  493701 NCBI-ProteinID:  NP_001009228 UniProt:  Q8SQ42 LinkDB All DBs Position A3:27001218..27046635 Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSRFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERSNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcggtttagtgatgtggaagagaacagaactgaggccccagaaggg actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacttggca gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcggtcaaacaagcgctgagggaggctggggatgagtttgaactgagg taccggcgggcattcagtgacctgacatcccagcttcacatcaccccagggacagcatat cagagctttgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggagagcgtagacaaggagatgcag gtattggtgagtcggatcgcagcttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggatacttttgtggaactctacgggaacaatgcagca gccgagagccggaagggccaggagcgctccaaccgctggttcctgacaggcatgactgtg gctggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system