KEGG   Felis catus (domestic cat): 493705
Entry
493705            CDS       T02385                                 
Symbol
HGF
Name
(RefSeq) hepatocyte growth factor precursor
  KO
K05460  hepatocyte growth factor
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca05144  Malaria
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05211  Renal cell carcinoma
fca05218  Melanoma
fca05223  Non-small cell lung cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    493705 (HGF)
   04014 Ras signaling pathway
    493705 (HGF)
   04015 Rap1 signaling pathway
    493705 (HGF)
   04020 Calcium signaling pathway
    493705 (HGF)
   04151 PI3K-Akt signaling pathway
    493705 (HGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    493705 (HGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493705 (HGF)
   05205 Proteoglycans in cancer
    493705 (HGF)
   05208 Chemical carcinogenesis - reactive oxygen species
    493705 (HGF)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    493705 (HGF)
   05226 Gastric cancer
    493705 (HGF)
   05218 Melanoma
    493705 (HGF)
   05211 Renal cell carcinoma
    493705 (HGF)
   05223 Non-small cell lung cancer
    493705 (HGF)
  09174 Infectious disease: parasitic
   05144 Malaria
    493705 (HGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    493705 (HGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493705 (HGF)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    493705 (HGF)
Cytokines and growth factors [BR:fca04052]
 Growth factors
  Growth factors (RTK binding)
   493705 (HGF)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   493705 (HGF)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 Trypsin_2 DUF1986 DUF316 CWC25
Other DBs
NCBI-GeneID: 493705
NCBI-ProteinID: NP_001009830
Ensembl: ENSFCAG00000008554
UniProt: Q9BH09
LinkDB
Position
A2:complement(87720244..87799864)
AA seq 728 aa
MWVTKLLPVLLLQHVLLHLLLLPIPYAEGQKKRRNTLHEFKKSAKTTLIKEDPLLKIKTK
KMNTADQCANRCIRNKGLPFTCKAFVFDKARKRCLWFPFNSMTSGVKKEFGHEFDLYENK
DYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNPRG
EEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKICQRWDRQTPHR
HKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSTMNDTDVPMET
TECIQGQGEGYRGTINSIWNGVPCQRWDSQYPHQHDITPENFKCKDLRENFCRNPDGAES
PWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWEKNMEDL
HRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDH
PVISCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIKESWILTARQCFPSRNKD
LKDYEAWLGIHDVHGRGDEKRKQVLNVSQLVYGPEGSDLVLLKLARPAVLDDFVSTIDLP
NYGCTIPEKTTCSVYGWGYTGSINSDGLLRVAHLYIMGNEKCSQYHQGKVTLNESEICAG
AENIVSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKII
LTYKIPQS
NT seq 2187 nt   +upstreamnt  +downstreamnt
atgtgggtgaccaaacttcttccagtcctgctgctgcagcacgtcctcctccacctcctt
ctgcttcccatcccctatgcagaaggacagaagaaaagaagaaacacacttcatgaattc
aaaaagtcagcaaagactactctaattaaagaagacccattactgaagataaaaacaaaa
aaaatgaacactgcagaccaatgtgccaatagatgtattaggaataaaggacttccattc
acttgcaaggcctttgtttttgataaagcaaggaaacgatgcctctggttccctttcaat
agcatgacaagtggagtgaaaaaagagtttggtcatgaattcgatctctatgaaaacaaa
gactacattagaaactgcatcattggcaaaggaggtagctacaagggaacagtatctatc
actaagagtggcatcaaatgccagccttggaattctatgataccacatgaacacagcttt
ttgccttcgagctatcggggtaaagacctacaggaaaactactgtcgaaatcctcgaggg
gaagaagggggaccttggtgtttcacaagcaatccagaggtacgctacgaagtctgtgac
attcctcagtgttcagaagttgaatgcatgacctgcaatggggaaagttatcgaggtccc
atggatcatacagaatcaggcaagatttgtcagcgctgggatcgtcagacaccacaccgg
cacaaattcttgccagaaagatatcccgacaagggctttgatgataattattgccgcaat
cctgatggcaagccgaggccatggtgctatactcttgaccctgacaccccctgggagtac
tgtgcaattaaaatgtgcgctcacagtactatgaatgacacagatgtgcctatggaaaca
actgaatgcattcagggtcaaggagaaggttaccggggcaccatcaactccatctggaat
ggagttccatgtcagcgttgggattcccagtatcctcaccagcatgacataactcctgaa
aatttcaagtgcaaggacctacgagaaaatttttgccgaaatccagatggagctgagtca
ccctggtgttttaccactgatccaaacatccgagttggctactgctcccaaattccaaaa
tgtgatgtgtcgagtggacaagattgttatcgtgggaatggcaaaaattatatgggcaat
ttatccaaaacacgatctggactaacatgttcaatgtgggagaagaacatggaagactta
cacaggcatatcttctgggaaccagatgctagtaagctgaataagaattactgccggaat
cctgatgatgatgcccatggcccctggtgttacacgggaaatcctctcattccatgggat
tattgtcctatttctcgttgtgaaggtgataccacacctacaatagtcaatttagaccat
cccgtaatatcttgtgccaaaacaaaacaactgcgagttgtaaatggaatcccaacgcgg
acaaatgtaggatggatggttagtttgaaatacagaaataaacatatctgtggaggatca
ttgataaaggaaagttggattcttaccgcaagacaatgtttcccttctcgaaacaaagac
ttgaaagattacgaagcttggcttgggattcatgatgtccacggaagaggagatgagaaa
cgcaaacaggttctaaatgtgtcccagctggtatatgggcctgaagggtcagatctggta
ttactgaagcttgctaggcctgctgtcctggatgattttgttagtacaattgatttacct
aattatggatgcaccattcctgaaaaaaccacttgcagtgtttatggctggggttatact
ggatcaatcaactctgatggtctattacgagtagcacatctctatattatggggaatgag
aaatgcagccaataccatcaagggaaggtgactctgaatgagtctgaaatatgtgcaggt
gccgaaaatattgtgtcaggaccatgtgagggagattatggtggcccacttgtttgtgaa
caacataaaatgagaatggtccttggtgtcattgttcctggtcgtggatgtgccattcca
aatcgtcctggcatttttgtccgagtagcatattatgcaaaatggatacacaaaattata
ttaacatataagataccacagtcatag

DBGET integrated database retrieval system