KEGG   Felis catus (domestic cat): 493706
Entry
493706            CDS       T02385                                 
Symbol
CSF1R
Name
(RefSeq) macrophage colony-stimulating factor 1 receptor precursor
  KO
K05090  macrophage colony-stimulating factor 1 receptor [EC:2.7.10.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04151  PI3K-Akt signaling pathway
fca04380  Osteoclast differentiation
fca04640  Hematopoietic cell lineage
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    493706 (CSF1R)
   04014 Ras signaling pathway
    493706 (CSF1R)
   04015 Rap1 signaling pathway
    493706 (CSF1R)
   04151 PI3K-Akt signaling pathway
    493706 (CSF1R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493706 (CSF1R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    493706 (CSF1R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    493706 (CSF1R)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    493706 (CSF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493706 (CSF1R)
   05202 Transcriptional misregulation in cancer
    493706 (CSF1R)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    493706 (CSF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    493706 (CSF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    493706 (CSF1R)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     493706 (CSF1R)
Protein kinases [BR:fca01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   493706 (CSF1R)
CD molecules [BR:fca04090]
 Proteins
  493706 (CSF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set HNF-1_N
Other DBs
NCBI-GeneID: 493706
NCBI-ProteinID: NP_001009231
Ensembl: ENSFCAG00000003633
UniProt: P13369
LinkDB
Position
A1:199096976..199126348
AA seq 980 aa
MGPRALLVLLVATAWHAQGVPVIQPSGPELVVEPGTTVTLRCVGNGSVEWDGPISPHWNL
DLDPPSSILTTNNATFQNTGTYHCTEPGNPQGGNATIHLYVKDPARPWKVLAQEVTVLEG
QDALLPCLLTDPALEAGVSLVRVRGRPVLRQTNYSFSPWHGFTIHKAKFIENHVYQCSAR
VDGRTVTSMGIWLKVQKDISGPATLTLEPAELVRIQGEAAQIVCSASNIDVNFDVSLRHG
DTKLTISQQSDFHDNRYQKVLTLNLDHVSFQDAGNYSCTATNAWGNHSASMVFRVVESAY
LNLTSEQSLLQEVTVGEKVDLQVKVEAYPGLESFNWTYLGPFSDYQDKLDFVTIKDTYRY
TSTLSLPRLKRSEAGRYSFLARNAGGQNALTFELTLRYPPEVRVTMTLINGSDTLLCEAS
GYPQPSVTWVQCRSHTDRCDESAGLVLEDSHSEVLSQVPFHEVIVHSLLAIGTLEHNRTY
ECRAFNSVGNSSQTFWPISIGAHTQLPDELLFTPVLLTCMSIMALLLLLLLLLLYKYKQK
PKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFG
LGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVIT
EYCCYGDLLNFLRRQAEAMLGPSLSVGQDPEAGAGYKNIHLEKKYVRRDSDFSSQGVDTY
VEMRPVSTSSSNDSFSEEDLGKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVAAR
NVLLTSGRVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWSYG
ILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTRRPT
FQQICSLLQKQAQEDRRVPNYTNLPSSSSSSSSSSSSCRTGSGGGSSSEPEEESSSEHLA
CCEQGDIAQPLLQPNNYQFC
NT seq 2943 nt   +upstreamnt  +downstreamnt
atgggcccaagggctctgctcgtcctgctggtggccacagcttggcatgctcaaggggtc
ccagtgatacagcccagcggccctgagctggtcgtggagccaggcacaacagtgaccctg
cgatgtgtgggcaacggcagcgtggaatgggacggccccatctccccccactggaacctg
gacctcgatccccccagcagcatcctgaccacgaataatgccaccttccaaaacacgggg
acctatcactgcactgagcctggaaacccccaggggggcaatgccaccatccacctctat
gtcaaagaccctgctcggccttggaaggtgctggcccaggaagtgacggtgttggaaggt
caggatgcgttgctgccctgcctgcttactgacccagcgttggaggcaggcgtctcgctg
gtgcgggtgcgtggccggcccgtcttgcgccaaaccaactattccttctcgccctggcat
ggcttcaccatccacaaggccaagttcattgagaatcacgtctaccaatgcagtgcgcga
gtagacggcaggacggtgacatcgatgggcatctggcttaaagtgcagaaagacatctcc
gggcctgcaaccttgacgctggagcctgcagagctggtgcggattcaaggagaggctgcc
cagatcgtgtgctcagccagcaacattgatgttaactttgacgtctccctccgtcatgga
gacaccaagctcacaatctctcaacaatccgacttccatgataaccgttaccaaaaagtc
ctgaccctcaacctcgatcacgtgagcttccaagatgctggcaactactcctgcacggcc
accaacgcctggggcaaccactccgcctccatggtcttccgggtggtagagagtgcctac
ttgaacttgacctctgagcagagtctcctccaggaggtgactgtgggtgagaaggttgat
ctccaagtcaaggtggaggcctacccaggcctagaaagttttaactggacctatctggga
cccttctctgactaccaggacaagctcgattttgtcaccatcaaggacacatacaggtac
acctcgaccctctccctgcctcgcctgaagcgctcggaggccggtcgctactccttcttg
gcccgaaacgctggaggccagaatgccctgacctttgagctcaccctgcgataccccccg
gaggtaagggtcacgatgaccctcatcaatggctctgacaccctgctctgtgaagcctcc
gggtacccccagcccagtgtgacgtgggtgcagtgcaggagccacaccgataggtgtgat
gagtctgcagggctcgtcctagaggactcacactctgaggtcctgagccaagtgcccttc
cacgaggtgatcgtccatagcctgctggccatcgggaccttggaacacaacaggacatat
gagtgtagagccttcaacagcgtggggaacagctcccagaccttctggcccatctctata
ggagcccacacgcagctccccgacgagctcctcttcacgcccgtgctgctcacttgcatg
tccatcatggccttgttgctgctgctgctcttgctgcttttgtacaagtataagcagaag
cccaagtaccaggtgcgctggaagatcatcgagagctacgagggcaacagctacaccttc
atcgaccccacccagctgccctacaatgagaagtgggagttcccccgaaacaacctgcag
tttggtaagactcttggagccggtgccttcgggaaggtggtagaggccacagcctttggt
ctgggcaaggaagatgccgtcctgaaggtggctgtgaagatgctgaagtccactgctcat
gcagatgagaaggaggccctcatgtcagaactgaagatcatgagtcacctgggccaacac
gagaacatagtcaaccttctgggagcctgtacccatggaggccctgttctggtcatcact
gagtactgttgctacggcgacctgctcaacttcctgcgaaggcaggctgaggccatgctg
ggccccagcctgagtgtgggccaggaccccgaggcaggcgctggctacaagaacatccac
ctggagaagaaatatgttcgcagagacagcgatttctccagtcagggtgtagacacctat
gtggagatgaggcctgtctccacttcttcttcaaatgactccttctctgaagaagacctg
ggcaaggaggacgggaggccactggagctacgggacctgctccacttctcgagccaggtg
gcccaggggatggccttccttgcctctaagaactgcatccaccgggacgtggcagcccga
aacgtcctgctgaccagtgggcgtgtggccaagattggggacttcgggttggctagggac
atcatgaatgactccaactacatcgtcaagggcaatgcccgcctgcctgtgaagtggatg
gctccggagagcatcttcgactgtgtctacacggttcagagcgacgtctggtcctatggc
atcttgctctgggaaatcttctcactcgggctgaacccctaccctggcatcctggtgaac
agcaagttctacaaactggtgaaggatggataccaaatggcccagcctgcattcgcccca
aagaacatatatagcatcatgcaggcctgctgggccctggagcccacccgcagacccacg
ttccagcagatctgctccctcctccagaagcaggcccaagaggacaggagagtgccgaac
tacaccaacttgccaagcagcagcagcagcagcagcagcagcagcagcagctgccgcact
ggcagtggcggtggcagcagtagtgagcccgaggaggagagctctagcgagcacctggcc
tgctgtgagcagggggatatcgcccagcccctgctgcagcccaacaactaccagttctgc
tga

DBGET integrated database retrieval system