KEGG   Felis catus (domestic cat): 493769
Entry
493769            CDS       T02385                                 
Symbol
CCR5
Name
(RefSeq) C-C chemokine receptor type 5
  KO
K04180  C-C chemokine receptor type 5
Organism
fca  Felis catus (domestic cat)
Pathway
fca03250  Viral life cycle - HIV-1
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04144  Endocytosis
fca05145  Toxoplasmosis
fca05163  Human cytomegalovirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    493769 (CCR5)
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493769 (CCR5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    493769 (CCR5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    493769 (CCR5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    493769 (CCR5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    493769 (CCR5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    493769 (CCR5)
   05163 Human cytomegalovirus infection
    493769 (CCR5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    493769 (CCR5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    493769 (CCR5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    493769 (CCR5)
   04050 Cytokine receptors [BR:fca04050]
    493769 (CCR5)
   04090 CD molecules [BR:fca04090]
    493769 (CCR5)
G protein-coupled receptors [BR:fca04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    493769 (CCR5)
Cytokine receptors [BR:fca04050]
 Chemokine receptors
  CC Chemokine
   493769 (CCR5)
CD molecules [BR:fca04090]
 Proteins
  493769 (CCR5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srab
Other DBs
NCBI-GeneID: 493769
NCBI-ProteinID: NP_001009248
Ensembl: ENSFCAG00000003003
UniProt: Q867D6
LinkDB
Position
A2:15933979..15937278
AA seq 352 aa
MDYQATSPYYDIEYELSEPCQKTDVRQIAARLLPPLYSLVFLSGFVGNLLVILILINCKK
LRGMTDVYLLNLAISDLLFLFTLPFWAHYAANGWVFGDGMCKTVTGLYHVGYFGGNFFII
LLTVDRYLAIVHAVFAVKARTVTFGAVTSAVTWAAAVVASLPGCIFSRSQKEGSRFTCSP
HFPSNQYHFWKNFQTLKMTILGLVLPLLVMIVCYSAILRTLFRCRNEKKKHRAVKLIFVI
MIGYFLFWAPNNIVLLLSTFPESFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRSYLLVFFQKHIARRFCKRCPVFQGKALDRASSVYTRSTGEQEISTGL
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggattatcaagccacgagcccctactatgacattgaatacgagctgtcggagccctgc
cagaaaaccgacgtgaggcaaatcgcagccagactcctgcctccgctctactcacttgtg
ttcctttccggcttcgtgggcaacctgctggtcatcctcatcctcatcaactgcaaaaag
ctgaggggcatgactgacgtctacctgctcaacctggccatctccgacctgctcttcctt
ttcaccctccccttctgggcccactatgccgccaacgggtgggtcttcggggatgggatg
tgtaagacggtcaccgggctctatcacgtcggctactttggcggaaacttcttcatcatc
ctcctgaccgtcgataggtacctggccatcgtccacgctgtgttcgctgtaaaggccagg
acggtcacctttggggcggtgacaagcgcggtcacctgggcggcggccgtggtcgcctct
ctgccggggtgtatcttcagcagatcccaaaaagaaggttcccgttttacgtgcagccct
cattttccatccaatcagtatcatttctggaagaacttccagacactgaagatgaccatc
ttgggcctggtcctgcccctgctcgtcatgatcgtctgctactcggccatcctcaggacc
ctgttccggtgtcggaacgagaagaagaagcacagggccgtgaagctcattttcgtgatc
atgatcggttactttctcttctgggcccccaacaacatcgtcctcctgctgagcaccttc
ccggagtcctttggcctcaataactgcagtagctccaacagactggaccaagccatgcag
gtgacggagaccctgggaatgacgcactgttgcatcaaccccatcatctacgccttcgtc
ggggagaagttcagaagctacctcttggtgttcttccaaaagcacatcgccaggcgcttc
tgcaaacgttgtcctgtcttccagggaaaggccctcgaccgagcgagctcggtttacacc
cgatccaccggagagcaggaaatatctacgggcttgtga

DBGET integrated database retrieval system