KEGG   Felis catus (domestic cat): 493799
Entry
493799            CDS       T02385                                 
Symbol
CD8A
Name
(RefSeq) T-cell surface glycoprotein CD8 alpha chain precursor
  KO
K06458  T-cell surface glycoprotein CD8 alpha chain
Organism
fca  Felis catus (domestic cat)
Pathway
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04660  T cell receptor signaling pathway
fca05135  Yersinia infection
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    493799 (CD8A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    493799 (CD8A)
   04612 Antigen processing and presentation
    493799 (CD8A)
   04660 T cell receptor signaling pathway
    493799 (CD8A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    493799 (CD8A)
  09163 Immune disease
   05340 Primary immunodeficiency
    493799 (CD8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    493799 (CD8A)
CD molecules [BR:fca04090]
 Proteins
  493799 (CD8A)
SSDB
Motif
Pfam: V-set Ig_3 ig I-set
Other DBs
NCBI-GeneID: 493799
NCBI-ProteinID: NP_001009843
Ensembl: ENSFCAG00000014826
UniProt: P41688
LinkDB
Position
A3:complement(103823408..103828429)
AA seq 239 aa
MASPVTAQLLPLALLLHAAAAAGPSPFRLSPVRVEGRLGQRVELQCEVLLSSAAPGCTWL
FQKNEPAARPIFLAYLSRSRTKLAEELDPKQISGQRIQDTLYSLTLHRFRKEEEGYYFCS
VVSNSVLYFSAFVPVFLPVKPTTTPAPRPPTQAPITTSQRVSLRPGTCQPSAGSTVEASG
LDLSCDIYIWAPLAGTCAFLLLSLVITVICNHRNRRRVCKCPRPVVRAGGKPSPSERYV
NT seq 720 nt   +upstreamnt  +downstreamnt
atggcctctccggtgactgcccagctcctgccgctggccttgctgcttcatgccgccgca
gccgccgggccgagcccgttccgcttatcgcccgtgagggtggagggcaggctcggccag
cgggtggagctgcagtgcgaggtgctgctgtccagcgcggcgccgggctgcacctggctc
ttccagaagaacgaacctgccgcccgccccatcttcctggcgtacctctccagaagccgg
accaagttggccgaggagctggaccccaaacagatctcgggccagaggattcaggacacc
ctctacagtctcaccctgcacagattccgcaaggaggaagaaggctactatttctgctcg
gtcgtgagcaactccgttctgtacttcagcgccttcgtcccggtcttcctgccagtcaag
cccaccactacgcccgcgccgcgaccgcccacgcaggcgcccatcaccacgtcgcagcgg
gtgtctctgcgcccggggacctgccagccttcagcgggcagcacagtggaagcaagtggg
ctggatttgtcctgtgacatctacatctgggcacccctggctgggacctgcgccttcctt
ctcctgtcgctggtcatcaccgtcatctgcaaccacaggaaccgaagacgtgtttgcaaa
tgtccgaggcccgtggtcagagcaggaggcaagcctagcccgtcagagagatacgtctaa

DBGET integrated database retrieval system