KEGG   Felis catus (domestic cat): 493839
Entry
493839            CDS       T02385                                 
Symbol
TLR9
Name
(RefSeq) toll-like receptor 9 precursor
  KO
K10161  toll-like receptor 9
Organism
fca  Felis catus (domestic cat)
Pathway
fca04620  Toll-like receptor signaling pathway
fca05132  Salmonella infection
fca05142  Chagas disease
fca05143  African trypanosomiasis
fca05144  Malaria
fca05152  Tuberculosis
fca05162  Measles
fca05168  Herpes simplex virus 1 infection
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    493839 (TLR9)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    493839 (TLR9)
  09172 Infectious disease: viral
   05162 Measles
    493839 (TLR9)
   05168 Herpes simplex virus 1 infection
    493839 (TLR9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    493839 (TLR9)
   05152 Tuberculosis
    493839 (TLR9)
  09174 Infectious disease: parasitic
   05144 Malaria
    493839 (TLR9)
   05142 Chagas disease
    493839 (TLR9)
   05143 African trypanosomiasis
    493839 (TLR9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:fca04054]
    493839 (TLR9)
   04090 CD molecules [BR:fca04090]
    493839 (TLR9)
Pattern recognition receptors [BR:fca04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   493839 (TLR9)
CD molecules [BR:fca04090]
 Proteins
  493839 (TLR9)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_12 TIR LRR_9 TIR_2
Other DBs
NCBI-GeneID: 493839
NCBI-ProteinID: NP_001009285
Ensembl: ENSFCAG00000024069
UniProt: Q5I2M7
LinkDB
Position
A2:complement(20820317..20830733)
AA seq 1031 aa
MGPCHGALHPLSLLVQAAALAVALAQGTLPAFLPCELQRHGLVNCDWLFLKSVPHFSAAA
PRGNVTSLSLYSNRIHHLHDSDFVHLSSLRRLNLKWNCPPASLSPMHFPCHMTIEPHTFL
AVPTLEELNLSYNSITTVPALPSSLVSLSLSRTNILVLDPANLAGLHSLRFLFLDGNCYY
KNPCPQALQVAPGALLGLGNLTHLSLKYNNLTAVPRGLPPSLEYLLLSYNHIITLAPEDL
ANLTALRVLDVGGNCRRCDHARNPCMECPKGFPHLHPDTFSHLNHLEGLVLKDSSLYNLN
PRWFHALGNLMVLDLSENFLYDCITKTTAFQGLAQLRRLNLSFNYHKKVSFAHLHLAPSF
GSLLSLQQLDMHGIFFRSLSETTLRSLVHLPMLQSLHLQMNFINQAQLSIFGAFPGLRYV
DLSDNRISGAMELAAATGEVDGGERVRLPSGDLALGPPGTPSSEGFMPGCKTLNFTLDLS
RNNLVTIQPEMFARLSRLQCLLLSRNSISQAVNGSQFMPLTSLQVLDLSHNKLDLYHGRS
FTELPRLEALDLSYNSQPFSMQGVGHNLSFVAQLPALRYLSLAHNDIHSRVSQQLCSASL
RALDFSGNALSRMWAEGDLYLXFFRGLRSLVRLDLSQNRLHTLLPRTLDNLPKSLRLLRL
RDNYLAFFNWSSLVLLPRLEALDLAGNQLKALSNGSLPNGTQLQRLDLSSNSISFVASSF
FALATRLRELNLSANALKTVEPSWFGSLAGTLKVLDVTGNPLHCACGAAFVDFLLEVQAA
VPGLPGHVKCGSPGQLQGRSIFAQDLRLCLDEALSWDCFGLSLLTVALGLAVPMLHHLCG
WDLWYCFHLCLAWLPRRGRRRGADALPYDAFVVFDKAQSAVADWVYNELRVRLEERRGRR
ALRLCLEERDWLPGKTLFENLWASVYSSRKMLFVLAHTDRVSGLLRASFLLAQQRLLEDR
KDVVVLVILRPDAHRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGTALTRDNQHFYN
QNFCRGPTTAE
NT seq 3096 nt   +upstreamnt  +downstreamnt
atgggcccctgccatggcgccctgcaccccctgtctctcctggtgcaggctgccgcgctg
gccgtggccctggcccagggcaccctgcctgcctttctgccctgtgagctccagcgccac
ggcctggtgaattgcgactggctgttcctcaagtccgtgccccacttctcggcggcagcg
ccccgtggtaacgtcaccagcctttccctgtactccaaccgcatccaccacctccacgac
tccgactttgtccacctgtccagcctgcggcgtctcaacctcaaatggaactgcccaccc
gccagcctcagccccatgcacttcccctgtcacatgaccattgagccccacaccttcctg
gccgtgcccaccctggaggagctgaacctgagctacaacagcatcacgacagtacccgcc
ctgcccagttccctcgtgtccctgtccttgagccgtaccaacatcctggtgctggaccct
gccaacctcgcagggctgcactccctgcgctttctgttcctggatggcaactgctactat
aagaacccctgcccgcaggccctgcaggtggccccgggcgccctccttggcctgggcaac
cttacgcacctgtcactcaagtacaacaacctcactgcggtgccccgcggcctgcccccc
agcctggagtacctgctattgtcctacaaccacatcatcaccctggcacctgaggacctg
gccaacctgaccgccctgcgtgtgctcgatgtgggtggaaactgccgtcgctgtgaccac
gcccgcaacccctgtatggagtgccccaagggcttcccgcacctgcaccctgacaccttc
agccacctgaaccacctcgaaggcctggtgttgaaggacagctctctctacaacctgaac
cccagatggttccatgccctgggcaacctcatggtgctggacctgagtgagaacttccta
tatgactgcatcaccaaaaccacagccttccagggcctggcccagctgcgcagactcaac
ttgtctttcaattaccacaagaaggtgtcctttgcccacctgcatctggcgccctccttc
gggagcctgctctccctgcagcagctggacatgcatggcatcttcttccgctcgctcagc
gagaccacgctccggtcgctggtccacctgcccatgctccagagtctgcacctgcagatg
aacttcatcaatcaggcccagctcagcatcttcggggccttccctggcctgcgatacgtg
gacctgtcagacaaccgcataagtggagccatggagctggcggctgccacgggggaggtg
gatggtggggagagagtccggctgccatctggggacctagctctgggcccaccgggcacc
cctagctccgagggcttcatgccaggctgcaagaccctcaacttcaccttggacctgtca
cggaacaacctagtgacaatccagccagagatgtttgcccggctctcgcgcctccagtgc
ctgctcctgagccgcaacagcatctcgcaggcagtcaacggctcacaatttatgccgctg
accagcctgcaggtgctggacctgtcccataacaagctggacctgtaccatgggcgctct
ttcacggagctgccgcggctggaggccctggacctcagctacaacagccagcccttcagc
atgcagggcgtgggtcacaacctcagctttgtggcacagctgccggccctgcgctatctc
agcctggcgcacaacgacatccacagccgtgtgtcccagcagctctgcagcgcctcgctg
cgggccttggacttcagcggcaatgccttgagccggatgtgggccgagggagacctgtat
ctccncttcttccgaggcctgaggagcctggtccggttggatctgtcccagaatcgcctg
cataccctcttgccacgcaccctggacaacctccccaagagcctgcggctgctgcgtctc
cgtgacaattatctggctttcttcaactggagcagcctggtcctcctccccaggctggaa
gccctggacctggcgggaaaccagctgaaggccctgagcaacggcagcttgcctaatgga
acccagctccagaggctggacctcagcagcaacagtatcagcttcgtggcctccagcttt
tttgctctggccaccaggctgcgagagctcaacctcagtgccaacgccctcaagacggtg
gagccctcctggttcggttctctagcgggcaccctgaaagtcctagatgtgactggcaac
cccctgcactgcgcctgcggggcggccttcgtggacttcttgctggaggtgcaggctgca
gtgcccggcctgccaggccacgtcaagtgtggcagtccaggtcagctccagggccgcagc
atctttgcgcaggatctgcgcctctgcctggatgaggccctctcctgggactgttttggc
ctctcgctgctgaccgtggccctgggcctggccgtgcccatgctgcaccacctctgtggc
tgggacctctggtactgcttccacctgtgcctggcctggctgccccggcgggggcggcgg
cggggcgcggatgccctgccctacgatgcctttgtggtcttcgacaaggcacagagcgcg
gtggccgactgggtgtacaacgagctgcgggtacggctagaggagcgccgtggacgccga
gcgctccgcctgtgcctggaggaacgtgactggctacccggtaaaacgctctttgagaac
ctgtgggcctcagtttacagcagccgcaagatgctgtttgtgctggcccacacagacagg
gtcagcggcctcttgcgcgccagctttctgctggcccagcagcgcctgctggaggaccgc
aaggacgttgtggtgctggtgatcctgcgccccgacgcccaccgctcccgctatgtgcgg
ctgcgccagcgcctctgccgccagagcgtcctcctctggccccaccagcccagtggccag
cgcagcttctgggcccagctgggcacggccctgaccagggacaaccagcacttctataac
cagaacttctgccggggccccacgacggcagagtga

DBGET integrated database retrieval system