KEGG   Felis catus (domestic cat): 493845
Entry
493845            CDS       T02385                                 
Symbol
VEGFA
Name
(RefSeq) vascular endothelial growth factor A precursor
  KO
K05448  vascular endothelial growth factor A
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04066  HIF-1 signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04370  VEGF signaling pathway
fca04510  Focal adhesion
fca04926  Relaxin signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05207  Chemical carcinogenesis - receptor activation
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05211  Renal cell carcinoma
fca05212  Pancreatic cancer
fca05219  Bladder cancer
fca05323  Rheumatoid arthritis
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    493845 (VEGFA)
   04014 Ras signaling pathway
    493845 (VEGFA)
   04015 Rap1 signaling pathway
    493845 (VEGFA)
   04370 VEGF signaling pathway
    493845 (VEGFA)
   04066 HIF-1 signaling pathway
    493845 (VEGFA)
   04020 Calcium signaling pathway
    493845 (VEGFA)
   04151 PI3K-Akt signaling pathway
    493845 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    493845 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    493845 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493845 (VEGFA)
   05206 MicroRNAs in cancer
    493845 (VEGFA)
   05205 Proteoglycans in cancer
    493845 (VEGFA)
   05207 Chemical carcinogenesis - receptor activation
    493845 (VEGFA)
   05208 Chemical carcinogenesis - reactive oxygen species
    493845 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    493845 (VEGFA)
   05211 Renal cell carcinoma
    493845 (VEGFA)
   05219 Bladder cancer
    493845 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    493845 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    493845 (VEGFA)
   05165 Human papillomavirus infection
    493845 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    493845 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    493845 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    493845 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    493845 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493845 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    493845 (VEGFA)
Cytokines and growth factors [BR:fca04052]
 Growth factors
  Growth factors (RTK binding)
   493845 (VEGFA)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   493845 (VEGFA)
SSDB
Motif
Pfam: PDGF VEGF_C
Other DBs
NCBI-GeneID: 493845
NCBI-ProteinID: NP_001009854
Ensembl: ENSFCAG00000026462
UniProt: Q95LQ4
LinkDB
Position
B2:44506726..44523396
AA seq 189 aa
MNFLLSWVHWSLALLLYLHHAKWSQAAPMADGEHKPHEVVKFMDVYQRSYCRPIETLVDI
FQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMS
FLQHSKCECRPKKDRAKENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNER
TCRCDKPRR
NT seq 570 nt   +upstreamnt  +downstreamnt
atgaactttctgctctcttgggtgcattggagccttgccttgctgctctacctccaccat
gccaagtggtcccaggctgcacccatggcagatggagagcacaaaccccacgaagtggtg
aagttcatggatgtctaccagcgcagctactgccgtcccatcgagaccctggtggacatc
ttccaggagtaccctgatgagatcgagtatatcttcaagccatcctgcgtgcccctgatg
cgatgcgggggctgttgcaatgacgagggcctggagtgtgtgcccacggaggagttcaac
atcaccatgcagattatgcggatcaaacctcatcaaggccagcacataggggagatgagc
ttcctacagcatagcaaatgtgaatgcagaccaaagaaagatagagcgaaagaaaatccc
tgtgggccttgctcagagcggagaaagcatttgtttgtacaagatccgcagacgtgtaaa
tgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagcttgagttaaacgaacgt
acttgcagatgtgacaagcccaggcggtga

DBGET integrated database retrieval system