KEGG   Felis catus (domestic cat): 493938
Entry
493938            CDS       T02385                                 
Symbol
IL18R1
Name
(RefSeq) interleukin-18 receptor 1 precursor
  KO
K05173  interleukin 18 receptor 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04668  TNF signaling pathway
fca05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    493938 (IL18R1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493938 (IL18R1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    493938 (IL18R1)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    493938 (IL18R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    493938 (IL18R1)
   04090 CD molecules [BR:fca04090]
    493938 (IL18R1)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL1 receptor family
   493938 (IL18R1)
CD molecules [BR:fca04090]
 Proteins
  493938 (IL18R1)
SSDB
Motif
Pfam: TIR Ig_2 V-set Ig_3 TIR_2 I-set ig Ig_6 LRRC37AB_C
Other DBs
NCBI-GeneID: 493938
NCBI-ProteinID: NP_001009863
Ensembl: ENSFCAG00000007750
UniProt: Q6YBY1
LinkDB
Position
A3:complement(60215725..60252761)
AA seq 539 aa
MRHIELLLTLLALMFTSTSETCISRHSITAVEGEFFYLRYCSSASEHDSEKNSIKWYKSS
GSHGRIELNSSSSPRITLHDYVLEFWPVELEDSGSYFFQMGNDTRKWKLNVIGRSKSSCF
VEKLLTSKTVEVQKSLHVACKHDYFQPLANRTSLYKNCEKINNGTNPVLQKNAEFEDQGY
YTCVFSIPHNGKLFNVTKTINVTIVGDRSKIIPVLLGPKLNRVKVELGKDVNLNCSALAN
EKDQIYWNLWDENGKEPNVHEENVKKNRTLDGKLYVSRMLKIENINAKNLKFSYNCTVAS
EGGTDTINFVLLKKEDMADIPGYIFTRGMIVAVLISVVVVCLVIMGVIYRVDLALFYRHF
TRKDETLTDGKTYDAFVSYLKECGPENGEEHTFAVEILPKVLEKHFGYKLCIYERDVVPG
GAIVDEIHSLIEKSRRLIIVLSKSYMSNEVRYELESGLHEALVERKIKIILIEFTPVSDF
TFFPQSLKLLKSHRVLKWNADKPLSYNSRFWKNLLYLMPAKVVKPRGTESEVFPVLSQS
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgcgtcatatagaactgctcttaacacttttggcacttatgtttacaagcacctcagaa
acatgtatttcacgtcatagcatcactgcagtggaaggggaatttttctatctgagatac
tgctcatcagcatctgagcacgatagtgaaaaaaacagcataaaatggtacaagagcagt
gggtcacatggacgcattgagctaaactcaagcagttcccccagaattactttgcacgat
tatgttttggagttttggccagttgagttggaggacagtggatcttactttttccaaatg
ggaaatgatactcgtaaatggaaattaaatgtcattggaagaagtaaaagcagctgtttt
gttgaaaaactactaactagtaaaactgtagaagttcagaaatctttgcacgtagcctgt
aaacatgactactttcaaccattggccaatagaacttcactgtataagaactgtgaaaag
ataaacaatggtacaaacccagttttacagaagaatgcagagtttgaagatcagggatat
tacacctgtgtgttttccatccctcataatggaaaactatttaatgtcaccaaaaccatc
aacgtaacaatcgttggagatcgcagtaaaataattcctgttcttcttggaccaaagctt
aaccgtgtgaaggtggaattaggaaaagatgtaaacctcaattgctctgctttggcgaat
gaaaaggatcagatttattggaacttgtgggatgaaaatggaaaggagcccaatgtacat
gaagagaacgtaaaaaaaaataggactctggatggcaaattgtatgtgtcaagaatgttg
aaaatcgagaatattaatgcaaaaaatctaaaattttcatataattgcactgtggccagt
gagggaggcacagacaccataaacttcgtcttgttgaaaaaagaagatatggctgatatc
ccaggctacatcttcaccagaggaatgattgtggctgttttgatctcagtggtagttgtg
tgcctagtgataatgggtgtcatttatagagttgacttggctctattttatagacatttc
acgagaaaagatgaaacattaacagatgggaaaacatacgacgcttttgtgtcttaccta
aaagaatgtggacccgaaaatggagaggagcacacctttgctgtggagattttgcccaag
gtgttggagaaacactttgggtataagttatgcatatatgaaagggatgtagtgcctgga
ggagctattgttgatgaaatccactcattgatagagaaaagccgaagactgatcattgtc
ctaagtaaaagctacatgtctaatgaagtcaggtatgaacttgaaagtggactccatgaa
gctctggtagaaaggaaaattaaaatcatcttaattgaatttacacctgtcagtgacttc
acattcttcccccaatcactaaagcttttgaaatctcacagagttctgaagtggaacgct
gataaacctctgtcgtataactcaaggttctggaagaatcttctgtacctgatgcctgca
aaagtggtcaagcctcgtggaactgaatctgaagtctttcctgttctttcacagtcctga

DBGET integrated database retrieval system