KEGG   Felis catus (domestic cat): 493953
Entry
493953            CDS       T02385                                 

Symbol
IL2RA
Name
(RefSeq) interleukin-2 receptor subunit alpha precursor
  KO
K05068  interleukin 2 receptor alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04144  Endocytosis
fca04151  PI3K-Akt signaling pathway
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca05162  Measles
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    493953 (IL2RA)
   04151 PI3K-Akt signaling pathway
    493953 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493953 (IL2RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    493953 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    493953 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    493953 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    493953 (IL2RA)
   04659 Th17 cell differentiation
    493953 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493953 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    493953 (IL2RA)
   05162 Measles
    493953 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    493953 (IL2RA)
   04090 CD molecules [BR:fca04090]
    493953 (IL2RA)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL2 receptor family
   493953 (IL2RA)
CD molecules [BR:fca04090]
 Proteins
  493953 (IL2RA)
SSDB
Motif
Pfam: Sushi TMEM100
Other DBs
NCBI-GeneID: 493953
NCBI-ProteinID: NP_001009355
Ensembl: ENSFCAG00000005794
UniProt: P41690
LinkDB
Position
B4
AA seq 275 aa
MEPSLLLWGILTFVVVHGHVTELCDENPPDIQHATFKALTYKTGTMLNCECKKGFRRISN
GSAFMLCAGNSSHSSWENQCRCISTSPRATDGQIIPKPEEQKGKSPMGMQSQMQPTDQVN
LPGHCREPPPWEHEDSRRIYHFVVGQTVHYQCMQGFRALKRGPAKSVCKTTCGKATWTQP
RLQCLSERSDGWFPDDEEPQASTDAALGSDTSCPSITASTTDFQRHTEVAMTTESFVFTT
EYQIAVAGCVLLLISIVLLSGLTWQRRWRKSRRTI
NT seq 828 nt   +upstreamnt  +downstreamnt
atggagccaagcctgctgctgtggggaatcctcacattcgtcgtggtacatggccacgtg
acagaactgtgtgatgaaaacccgccagatatccaacacgccacattcaaagccctcaca
tacaagacgggcaccatgttaaattgtgaatgtaagaagggcttccgcagaataagcaac
gggtcagccttcatgctgtgtgcaggaaactcgagccactcctcctgggaaaaccaatgc
cggtgcataagtacctccccaagggccacagatggacaaattatccctaaacctgaagaa
cagaagggaaaaagccccatgggaatgcagagccaaatgcagcccacggaccaagttaac
cttccaggtcactgcagggagcctccgccctgggaacatgaagattcgaggagaatttac
cattttgtggtggggcagacagttcactaccagtgcatgcagggattcagggccctgaag
aggggtcctgccaagagtgtctgcaaaacgacctgtgggaaggcaacgtggacacagccc
cgactccagtgcctaagcgaaaggagtgatggctggtttccggatgacgaagagcctcaa
gccagcactgatgctgctcttgggagtgacacttcctgtccctcaataacagcaagtact
acagatttccagagacatacggaagtggctatgaccacggagtcattcgtattcacaacc
gagtatcagatagcagtggccggctgcgtcctcctgctgatcagtatcgtccttctgagc
gggctcacctggcagcggagatggaggaagagtagaagaacaatctag

DBGET integrated database retrieval system