Felis catus (domestic cat): 493974 Help Entry 493974            CDS       T02385                                  Symbol MYL5 Name (RefSeq) myosin light chain 5   KO K12753   myosin regulatory light chain 5 Organism fca  Felis catus (domestic cat) Pathway fca04360   Axon guidance fca04510   Focal adhesion fca04520   Adherens junction fca04670   Leukocyte transendothelial migration fca04810   Regulation of actin cytoskeleton fca04814   Motor proteins fca04820   Cytoskeleton in muscle cells fca05132   Salmonella infection Brite KEGG Orthology (KO) [BR:fca00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     493974 (MYL5)    04520 Adherens junction     493974 (MYL5)   09142 Cell motility    04814 Motor proteins     493974 (MYL5)    04820 Cytoskeleton in muscle cells     493974 (MYL5)    04810 Regulation of actin cytoskeleton     493974 (MYL5)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     493974 (MYL5)   09158 Development and regeneration    04360 Axon guidance     493974 (MYL5)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     493974 (MYL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:fca04812]     493974 (MYL5) Cytoskeleton proteins [BR:fca04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      493974 (MYL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 EF_EFCAB10_C AIF-1 Motif Other DBs NCBI-GeneID:  493974 NCBI-ProteinID:  NP_001009874 UniProt:  P41691 LinkDB All DBs Position B1:complement(205193908..205197398) Genome browser AA seq 173 aa AA seqDB search MASRKTKKKEGGGLRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYA SLGKTNIKDDELDAMLKEASGPINFTMFLNMFGAKLTGTDAEETILNAFKMLDPEGKGSI NKDYIKPLLMSHADKMTAEEVDQMFQFATIDAAGNLDYKALSYVLTHGEEKEE NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atggccagcaggaagaccaagaagaaggaaggggggggccttcgggcccagagagcatca tccaacgtcttttccaacttcgagcagacccagatccaggagttcaaggaggcattcacg ctgatggatcagaaccgagatggctttattgacaaggaggatctgaaggacacctatgcc tccctgggcaaaaccaacatcaaggatgatgagttggatgccatgctcaaggaggcctcg ggacccatcaacttcaccatgttcctgaatatgtttggggcgaagctgacgggtacggat gccgaagagaccatcctaaatgccttcaagatgctggatcctgaaggcaaaggcagcatc aacaaggactacatcaagccgctgttgatgtctcacgcagacaagatgaccgctgaagag gttgaccagatgttccagtttgccaccatcgatgctgcaggcaacctggactacaaggca ctgagctacgtgctcacccacggggaggagaaggaggagtga

DBGET integrated database retrieval system