KEGG   Felis catus (domestic cat): 552888
Entry
552888            CDS       T02385                                 
Symbol
ESR1
Name
(RefSeq) estrogen receptor
  KO
K08550  estrogen receptor alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04915  Estrogen signaling pathway
fca04917  Prolactin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05207  Chemical carcinogenesis - receptor activation
fca05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    552888 (ESR1)
   04917 Prolactin signaling pathway
    552888 (ESR1)
   04919 Thyroid hormone signaling pathway
    552888 (ESR1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    552888 (ESR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    552888 (ESR1)
   05205 Proteoglycans in cancer
    552888 (ESR1)
   05207 Chemical carcinogenesis - receptor activation
    552888 (ESR1)
  09162 Cancer: specific types
   05224 Breast cancer
    552888 (ESR1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    552888 (ESR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    552888 (ESR1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:fca03310]
    552888 (ESR1)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    552888 (ESR1)
Nuclear receptors [BR:fca03310]
 3. Estrogen like
  3A. Estrogen receptor
   552888 (ESR1)
SSDB
Motif
Pfam: Oest_recep Hormone_recep zf-C4 ESR1_C
Other DBs
NCBI-GeneID: 552888
NCBI-ProteinID: NP_001019402
Ensembl: ENSFCAG00000031492
UniProt: Q53AD2
LinkDB
Position
B2:139615068..139891043
AA seq 595 aa
MTMTLHTKASGMALLHQIQGNELETLNRPQLKIPLERPLGEVYVDGSKPAVYNYPEGAAY
DFNAAAAASAPVYGQSGLAYGSGSEAAAFGANGLGGFPPLNSVSPSPLVLLHPPPQLSPF
LHPHGQQVPYYLENEPSGYAVREAGPPAFYRPTSDNRRQSGRERLASTGDKGSMAMESAK
ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDEGEGRNEVGSSGDVRASNLWPSPLLIKH
TKKNSPALSLTADQMVSALLEAEPPIIYSDYDPSRPFSEASMMGLLTNLADRELVHMINW
AKRVPGFVDLSLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
KITDTLIHLMAKAGLSLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPLYDLL
LEMLDAHRLHAPANRGGAPMEEMNQSQLATTGSTSAHSLQAYYITEEAGAFPTTV
NT seq 1788 nt   +upstreamnt  +downstreamnt
atgaccatgaccctccacaccaaagcgtctggaatggccctgctgcatcaaatccaaggg
aacgagctggagaccctgaaccgcccgcagctcaagatccccctggagcggcccctgggc
gaggtgtacgtggacggcagcaagcccgccgtgtacaactatcccgagggcgccgcgtac
gacttcaacgccgcggccgccgcctccgcgccggtctacggccagtcgggcctcgcctat
ggctccgggtccgaggcggcggcgttcggcgccaacggcctggggggcttcccgccgctc
aacagcgtgtctccgagcccgctggtgctgctgcacccgccgccgcagctctcgcccttc
ctgcacccccacggccagcaggtgccctattacctggagaacgagccgagcggctacgcc
gtgcgcgaggccggtcctcccgcgttctacaggcccacttcagacaatcggcgccagagt
ggcagagagagattggccagtactggtgataagggaagcatggccatggagtctgccaag
gagacccgctactgtgcagtatgcaatgactatgcctcaggctaccattatggagtatgg
tcctgtgagggctgtaaggccttcttcaagagaagtattcaaggacataatgactacatg
tgtccagctaccaaccagtgcacgatcgataagaacaggaggaagagttgtcaggcctgc
cggctccggaagtgctatgaagtaggcatgatgaaaggcggaatacggaaagaccgaaga
ggaggaagaatgttgaaacacaagcgccagagagatgagggggagggcaggaatgaagtg
gggtcttccggagatgtgagggcttccaacctttggccaagccctctcttgattaagcat
actaagaagaacagcccagccttgtccctgacagccgatcagatggtcagtgccttgttg
gaggctgagccccccataatctattccgactacgatccttccagacccttcagtgaggct
tcgatgatgggcttgctgaccaaccttgctgacagggagctggttcacatgatcaactgg
gcaaagagggtgccaggctttgttgatttgagcctccacgatcaggttcaccttctggaa
tgtgcctggctagagatcctgatgattggacttgtctggcgctccatggagcatccaggg
aagctcctatttgctcccaacttgctcctggacaggaaccagggaaaatgtgtagagggg
atggtggagatctttgacatgttgctggctacgtcatctcgatttcgcatgatgaatctc
cagggagaggagttcgtgtgtctcaaatccatcattttgcttaattctggagtgtacaca
tttctgtccagcaccctgaagtctctggaagagaaggaccatatccatcgtgtcttggac
aagatcacagacaccttgatccacctgatggccaaagcgggcctgtctctgcagcagcag
caccggcgtctggcccagctcctcctcatcctgtcccacatcaggcacatgagtaacaaa
ggcatggagcacctgtacaacatgaagtgcaaaaacgtagtgcctctctacgacctgctg
ttggagatgctggacgcccaccgcctgcacgccccagccaaccgggggggcgcacccatg
gaggagatgaaccagagccagctggccaccacgggctcaacttcagcacattccttgcaa
gcatattacatcaccgaggaggcaggggctttccccaccacagtctga

DBGET integrated database retrieval system