KEGG   Felis catus (domestic cat): 751105
Entry
751105            CDS       T02385                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04062  Chemokine signaling pathway
fca04068  FoxO signaling pathway
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04137  Mitophagy - animal
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04218  Cellular senescence
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04371  Apelin signaling pathway
fca04540  Gap junction
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04625  C-type lectin receptor signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04714  Thermogenesis
fca04720  Long-term potentiation
fca04722  Neurotrophin signaling pathway
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04730  Long-term depression
fca04810  Regulation of actin cytoskeleton
fca04910  Insulin signaling pathway
fca04912  GnRH signaling pathway
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04917  Prolactin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04921  Oxytocin signaling pathway
fca04926  Relaxin signaling pathway
fca04929  GnRH secretion
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04935  Growth hormone synthesis, secretion and action
fca05010  Alzheimer disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05034  Alcoholism
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05207  Chemical carcinogenesis - receptor activation
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05216  Thyroid cancer
fca05218  Melanoma
fca05219  Bladder cancer
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05230  Central carbon metabolism in cancer
fca05231  Choline metabolism in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    751105 (NRAS)
   04012 ErbB signaling pathway
    751105 (NRAS)
   04014 Ras signaling pathway
    751105 (NRAS)
   04015 Rap1 signaling pathway
    751105 (NRAS)
   04370 VEGF signaling pathway
    751105 (NRAS)
   04371 Apelin signaling pathway
    751105 (NRAS)
   04068 FoxO signaling pathway
    751105 (NRAS)
   04072 Phospholipase D signaling pathway
    751105 (NRAS)
   04071 Sphingolipid signaling pathway
    751105 (NRAS)
   04151 PI3K-Akt signaling pathway
    751105 (NRAS)
   04150 mTOR signaling pathway
    751105 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    751105 (NRAS)
   04137 Mitophagy - animal
    751105 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    751105 (NRAS)
   04218 Cellular senescence
    751105 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    751105 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    751105 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    751105 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    751105 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    751105 (NRAS)
   04660 T cell receptor signaling pathway
    751105 (NRAS)
   04662 B cell receptor signaling pathway
    751105 (NRAS)
   04664 Fc epsilon RI signaling pathway
    751105 (NRAS)
   04062 Chemokine signaling pathway
    751105 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    751105 (NRAS)
   04929 GnRH secretion
    751105 (NRAS)
   04912 GnRH signaling pathway
    751105 (NRAS)
   04915 Estrogen signaling pathway
    751105 (NRAS)
   04917 Prolactin signaling pathway
    751105 (NRAS)
   04921 Oxytocin signaling pathway
    751105 (NRAS)
   04926 Relaxin signaling pathway
    751105 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    751105 (NRAS)
   04919 Thyroid hormone signaling pathway
    751105 (NRAS)
   04916 Melanogenesis
    751105 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    751105 (NRAS)
   04726 Serotonergic synapse
    751105 (NRAS)
   04720 Long-term potentiation
    751105 (NRAS)
   04730 Long-term depression
    751105 (NRAS)
   04722 Neurotrophin signaling pathway
    751105 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    751105 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    751105 (NRAS)
   04213 Longevity regulating pathway - multiple species
    751105 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    751105 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    751105 (NRAS)
   05206 MicroRNAs in cancer
    751105 (NRAS)
   05205 Proteoglycans in cancer
    751105 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    751105 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    751105 (NRAS)
   05203 Viral carcinogenesis
    751105 (NRAS)
   05230 Central carbon metabolism in cancer
    751105 (NRAS)
   05231 Choline metabolism in cancer
    751105 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    751105 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    751105 (NRAS)
   05225 Hepatocellular carcinoma
    751105 (NRAS)
   05226 Gastric cancer
    751105 (NRAS)
   05214 Glioma
    751105 (NRAS)
   05216 Thyroid cancer
    751105 (NRAS)
   05221 Acute myeloid leukemia
    751105 (NRAS)
   05220 Chronic myeloid leukemia
    751105 (NRAS)
   05218 Melanoma
    751105 (NRAS)
   05211 Renal cell carcinoma
    751105 (NRAS)
   05219 Bladder cancer
    751105 (NRAS)
   05215 Prostate cancer
    751105 (NRAS)
   05213 Endometrial cancer
    751105 (NRAS)
   05224 Breast cancer
    751105 (NRAS)
   05223 Non-small cell lung cancer
    751105 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    751105 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    751105 (NRAS)
   05161 Hepatitis B
    751105 (NRAS)
   05160 Hepatitis C
    751105 (NRAS)
   05163 Human cytomegalovirus infection
    751105 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    751105 (NRAS)
   05165 Human papillomavirus infection
    751105 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    751105 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    751105 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    751105 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    751105 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    751105 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    751105 (NRAS)
   01522 Endocrine resistance
    751105 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    751105 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    751105 (NRAS)
   04031 GTP-binding proteins [BR:fca04031]
    751105 (NRAS)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    751105 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    751105 (NRAS)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   751105 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   751105 (NRAS)
  Exosomal proteins of breast cancer cells
   751105 (NRAS)
  Exosomal proteins of colorectal cancer cells
   751105 (NRAS)
GTP-binding proteins [BR:fca04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    751105 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 751105
NCBI-ProteinID: XP_019693224
Ensembl: ENSFCAG00000037994
UniProt: A0A2I2UNV5
LinkDB
Position
C1:complement(97949520..97959819)
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaaacaggtggttatagacggtgaaacctgtctgttggacatactggatacagctggt
caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt
gtatttgccatcaacaatagcaaatcatttgcagatattaacctttacagggaacagatt
aagcgagtaaaagactccgatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccaacaaggaccgtcgacacaaaacaagcccacgaactggccaagagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta
agagaaatacgtcagtaccgaatgaagaaactcaacagcagtgatgacgggactcaaggt
tgtatggggttaccgtgtgtggtgatgtaa

DBGET integrated database retrieval system