Felis catus (domestic cat): 751105 Help Entry 751105            CDS       T02385                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism fca  Felis catus (domestic cat) Pathway fca01521   EGFR tyrosine kinase inhibitor resistance fca01522   Endocrine resistance fca04010   MAPK signaling pathway fca04012   ErbB signaling pathway fca04014   Ras signaling pathway fca04015   Rap1 signaling pathway fca04062   Chemokine signaling pathway fca04068   FoxO signaling pathway fca04071   Sphingolipid signaling pathway fca04072   Phospholipase D signaling pathway fca04137   Mitophagy - animal fca04140   Autophagy - animal fca04150   mTOR signaling pathway fca04151   PI3K-Akt signaling pathway fca04210   Apoptosis fca04211   Longevity regulating pathway fca04213   Longevity regulating pathway - multiple species fca04218   Cellular senescence fca04360   Axon guidance fca04370   VEGF signaling pathway fca04371   Apelin signaling pathway fca04540   Gap junction fca04550   Signaling pathways regulating pluripotency of stem cells fca04625   C-type lectin receptor signaling pathway fca04650   Natural killer cell mediated cytotoxicity fca04660   T cell receptor signaling pathway fca04662   B cell receptor signaling pathway fca04664   Fc epsilon RI signaling pathway fca04714   Thermogenesis fca04720   Long-term potentiation fca04722   Neurotrophin signaling pathway fca04725   Cholinergic synapse fca04726   Serotonergic synapse fca04730   Long-term depression fca04810   Regulation of actin cytoskeleton fca04910   Insulin signaling pathway fca04912   GnRH signaling pathway fca04915   Estrogen signaling pathway fca04916   Melanogenesis fca04917   Prolactin signaling pathway fca04919   Thyroid hormone signaling pathway fca04921   Oxytocin signaling pathway fca04926   Relaxin signaling pathway fca04929   GnRH secretion fca04933   AGE-RAGE signaling pathway in diabetic complications fca04935   Growth hormone synthesis, secretion and action fca05010   Alzheimer disease fca05022   Pathways of neurodegeneration - multiple diseases fca05034   Alcoholism fca05160   Hepatitis C fca05161   Hepatitis B fca05163   Human cytomegalovirus infection fca05165   Human papillomavirus infection fca05166   Human T-cell leukemia virus 1 infection fca05167   Kaposi sarcoma-associated herpesvirus infection fca05170   Human immunodeficiency virus 1 infection fca05200   Pathways in cancer fca05203   Viral carcinogenesis fca05205   Proteoglycans in cancer fca05206   MicroRNAs in cancer fca05207   Chemical carcinogenesis - receptor activation fca05208   Chemical carcinogenesis - reactive oxygen species fca05210   Colorectal cancer fca05211   Renal cell carcinoma fca05213   Endometrial cancer fca05214   Glioma fca05215   Prostate cancer fca05216   Thyroid cancer fca05218   Melanoma fca05219   Bladder cancer fca05220   Chronic myeloid leukemia fca05221   Acute myeloid leukemia fca05223   Non-small cell lung cancer fca05224   Breast cancer fca05225   Hepatocellular carcinoma fca05226   Gastric cancer fca05230   Central carbon metabolism in cancer fca05231   Choline metabolism in cancer fca05235   PD-L1 expression and PD-1 checkpoint pathway in cancer fca05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     751105 (NRAS)    04015 Rap1 signaling pathway     751105 (NRAS)    04068 FoxO signaling pathway     751105 (NRAS)    04072 Phospholipase D signaling pathway     751105 (NRAS)    04071 Sphingolipid signaling pathway     751105 (NRAS)    04151 PI3K-Akt signaling pathway     751105 (NRAS)    04150 mTOR signaling pathway     751105 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     751105 (NRAS)    04137 Mitophagy - animal     751105 (NRAS)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     751105 (NRAS)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     751105 (NRAS)    04660 T cell receptor signaling pathway     751105 (NRAS)    04662 B cell receptor signaling pathway     751105 (NRAS)    04664 Fc epsilon RI signaling pathway     751105 (NRAS)    04062 Chemokine signaling pathway     751105 (NRAS)   09152 Endocrine system    04929 GnRH secretion     751105 (NRAS)    04915 Estrogen signaling pathway     751105 (NRAS)    04917 Prolactin signaling pathway     751105 (NRAS)    04921 Oxytocin signaling pathway     751105 (NRAS)    04926 Relaxin signaling pathway     751105 (NRAS)    04935 Growth hormone synthesis, secretion and action     751105 (NRAS)    04919 Thyroid hormone signaling pathway     751105 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     751105 (NRAS)    04726 Serotonergic synapse     751105 (NRAS)    04720 Long-term potentiation     751105 (NRAS)    04730 Long-term depression     751105 (NRAS)    04722 Neurotrophin signaling pathway     751105 (NRAS)   09158 Development and regeneration    04360 Axon guidance     751105 (NRAS)   09149 Aging    04211 Longevity regulating pathway     751105 (NRAS)    04213 Longevity regulating pathway - multiple species     751105 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     751105 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     751105 (NRAS)    05206 MicroRNAs in cancer     751105 (NRAS)    05205 Proteoglycans in cancer     751105 (NRAS)    05207 Chemical carcinogenesis - receptor activation     751105 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     751105 (NRAS)    05203 Viral carcinogenesis     751105 (NRAS)    05230 Central carbon metabolism in cancer     751105 (NRAS)    05231 Choline metabolism in cancer     751105 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     751105 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     751105 (NRAS)    05225 Hepatocellular carcinoma     751105 (NRAS)    05226 Gastric cancer     751105 (NRAS)    05214 Glioma     751105 (NRAS)    05216 Thyroid cancer     751105 (NRAS)    05221 Acute myeloid leukemia     751105 (NRAS)    05220 Chronic myeloid leukemia     751105 (NRAS)    05218 Melanoma     751105 (NRAS)    05211 Renal cell carcinoma     751105 (NRAS)    05219 Bladder cancer     751105 (NRAS)    05215 Prostate cancer     751105 (NRAS)    05213 Endometrial cancer     751105 (NRAS)    05224 Breast cancer     751105 (NRAS)    05223 Non-small cell lung cancer     751105 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     751105 (NRAS)    05170 Human immunodeficiency virus 1 infection     751105 (NRAS)    05161 Hepatitis B     751105 (NRAS)    05160 Hepatitis C     751105 (NRAS)    05163 Human cytomegalovirus infection     751105 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     751105 (NRAS)    05165 Human papillomavirus infection     751105 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     751105 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     751105 (NRAS)   09165 Substance dependence    05034 Alcoholism     751105 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     751105 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     751105 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     751105 (NRAS)    01522 Endocrine resistance     751105 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fca04131]     751105 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     751105 (NRAS)    04031 GTP-binding proteins [BR:fca04031]     751105 (NRAS) Membrane trafficking [BR:fca04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     751105 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     751105 (NRAS) Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    751105 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    751105 (NRAS)   Exosomal proteins of breast cancer cells    751105 (NRAS)   Exosomal proteins of colorectal cancer cells    751105 (NRAS) GTP-binding proteins [BR:fca04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     751105 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  751105 NCBI-ProteinID:  XP_019693224 Ensembl:  ENSFCAG00000037994 UniProt:  A0A2I2UNV5 LinkDB All DBs Position C1:complement(97949520..97959819) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagacggtgaaacctgtctgttggacatactggatacagctggt caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaacaatagcaaatcatttgcagatattaacctttacagggaacagatt aagcgagtaaaagactccgatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggaccgtcgacacaaaacaagcccacgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaagaaactcaacagcagtgatgacgggactcaaggt tgtatggggttaccgtgtgtggtgatgtaa

DBGET integrated database retrieval system