KEGG   Flavobacterium cyclinae: LOS86_11100
Entry
LOS86_11100       CDS       T08416                                 
Name
(GenBank) acylneuraminate cytidylyltransferase family protein
  KO
K24307  5-N-acetyl-7-N-(D-alanyl)-legionaminic acid cytidylyltransferase
Organism
fcc  Flavobacterium cyclinae
Pathway
fcc00541  O-Antigen nucleotide sugar biosynthesis
fcc01100  Metabolic pathways
fcc01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:fcc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    LOS86_11100
SSDB
Motif
Pfam: CTP_transf_3
Other DBs
NCBI-ProteinID: UGS20561
LinkDB
Position
complement(2392898..2393599)
AA seq 233 aa
MRILGIIPARGGSKGVPGKNIKLLGEFPLLAYTAKSALASKYLSKVILSTDCYDIANVAK
EFGIEVPFMRPEHLATDTASSIEVVQHAISFFEKQGEFFDAVCLLQPTAPFRMNGFIDQA
IQKFINDKSDALVSVLPVPHEFNPHWVFEPNEEGLLKIATGEAEIIKRRQELPKAFFRDG
SVYITKTEVIKEGSFYGNQLSYLENNPDFYVNIDTLNDWEIALSKLPLIKSLL
NT seq 702 nt   +upstreamnt  +downstreamnt
atgcgtattttaggtatcattccagccagaggaggttcaaaaggtgttccagggaaaaat
ataaaattacttggtgaattccctttgttggcttacacggcaaaatcagctttggcctct
aaatatcttagcaaagtaatcctttcaacagattgttatgatattgcgaatgtagcaaaa
gaatttggtatagaagttccttttatgcgtccagaacatttggcaacagacacggcttct
agtattgaagtagtgcaacatgccatttctttttttgaaaagcaaggtgaattttttgat
gctgtttgtttgttacaacctacagctccttttcgtatgaatggctttattgatcaggca
attcaaaaatttataaatgataaatccgatgctttagttagtgttttgcctgtaccgcat
gagtttaatcctcattgggtatttgaacctaacgaagaaggtttgctaaaaattgcaacg
ggtgaagcagaaattataaaaagaagacaagagttgcccaaggcgttttttagagatgga
tctgtttatataactaaaacagaagttattaaagaaggaagtttttatggaaatcaattg
agttacctagaaaataatcctgatttttatgtcaatattgatactttaaatgattgggaa
attgctttgtcaaaattacccttaattaaatccctattataa

DBGET integrated database retrieval system