Folsomia candida: 110847556 Help Entry 110847556         CDS       T05043                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism fcd  Folsomia candida Pathway fcd04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:fcd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     110847556  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:fcd04121]     110847556    03400 DNA repair and recombination proteins [BR:fcd03400]     110847556 Ubiquitin system [BR:fcd04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      110847556    Cul5 complex      110847556 DNA repair and recombination proteins [BR:fcd03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      110847556 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD TBK1_ULD Motif Other DBs NCBI-GeneID:  110847556 NCBI-ProteinID:  XP_021950205 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search MLDRQNNPLEITTMDVFLMVCRKKTTIFLDAKEDTQVLELKKMIAGITKVKPSNQRLFKE REELKDERTLAEYGFTANSAKPQKPGSIGLAFRNENGDWEDLEITPLSLPPELPEVMRPQ ETAQSEQQTA NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgttggaccggcaaaataatcctcttgaaataactacaatggacgtgtttttaatggtt tgtcgaaagaagacgacaatcttcttggacgccaaagaagacactcaagttcttgaacta aaaaaaatgattgcaggaattacgaaagtgaaaccaagcaatcagcgtctgttcaaggaa cgagaggagttaaaggatgagcgaacattagcagagtatggatttacagcaaattcagct aaaccacaaaagcctggatcaatcggactggcttttagaaacgaaaatggcgattgggaa gatttggaaataacaccattgtctctgcctccagagcttccggaagtgatgagaccacaa gaaacagcacagtcagaacagcagactgcataa

DBGET integrated database retrieval system