Folsomia candida: 110853710 Help Entry 110853710         CDS       T05043                                  Name (RefSeq) ubiquitin-like   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism fcd  Folsomia candida Pathway fcd03010   Ribosome fcd04120   Ubiquitin mediated proteolysis fcd04137   Mitophagy - animal fcd04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:fcd00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     110853710   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     110853710  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     110853710    04137 Mitophagy - animal     110853710  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:fcd03011]     110853710    04121 Ubiquitin system [BR:fcd04121]     110853710   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fcd04147]     110853710 Ribosome [BR:fcd03011]  Ribosomal proteins   Eukaryotes    Small subunit     110853710   Archaea     110853710 Ubiquitin system [BR:fcd04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    110853710 Exosome [BR:fcd04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110853710   Exosomal proteins of colorectal cancer cells    110853710 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 DUF2604 IBR Dsc3_N TBK1_ULD Ubiquitin_5 OTU1_UBXL Motif Other DBs NCBI-GeneID:  110853710 NCBI-ProteinID:  XP_021957711 LinkDB All DBs Position Unknown AA seq 152 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGAKKRKKKNYTTPKKIKHKKKKVKLPVLKYYKVDENGKIHRLRRE CPSESCGAGIFMASMEDRHYCGKCGATYVYNA NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgcaaatcttcgtgaaaaccctcacgggcaagaccatcactcttgaggtcgagcctagt gacacgatcgagaatgtcaaggcaaaaatccaggacaaggaaggaatccccccagatcag cagaggcttatctttgccggaaagcagctcgaggatgggaggacgttgagcgattataac atccaaaaagagtccacccttcatctcgtcctccgcctcagagggggggcgaagaaaagg aagaagaaaaattacacgactcctaagaaaattaaacataagaagaagaaggttaagttg cccgttcttaagtactacaaggttgacgaaaacggaaagatccaccgtttgagaagagag tgccctagcgaatcctgtggagctggaatttttatggcttcaatggaagaccgacattat tgtgggaaatgcggggcgacttatgtttataacgcataa

DBGET integrated database retrieval system