KEGG   Folsomia candida: 110854088
Entry
110854088         CDS       T05043                                 
Name
(RefSeq) S-phase kinase-associated protein 1-like
  KO
K03094  S-phase kinase-associated protein 1
Organism
fcd  Folsomia candida
Pathway
fcd03083  Polycomb repressive complex
fcd04120  Ubiquitin mediated proteolysis
fcd04141  Protein processing in endoplasmic reticulum
fcd04310  Wnt signaling pathway
fcd04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110854088
   04120 Ubiquitin mediated proteolysis
    110854088
  09126 Chromosome
   03083 Polycomb repressive complex
    110854088
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110854088
   04350 TGF-beta signaling pathway
    110854088
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fcd04131]
    110854088
   04121 Ubiquitin system [BR:fcd04121]
    110854088
   03036 Chromosome and associated proteins [BR:fcd03036]
    110854088
Membrane trafficking [BR:fcd04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    110854088
Ubiquitin system [BR:fcd04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     110854088
   Cul7 complex
     110854088
Chromosome and associated proteins [BR:fcd03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     110854088
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     110854088
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 110854088
NCBI-ProteinID: XP_021958177
LinkDB
Position
Unknown
AA seq 162 aa
MPDVILQSSDNENFTVSLEVAKMSATVKTLLEDLGYAEDKPDTIPLPNVRGEILRLVVNW
CNQHKNDTPLPEDDEGREKRTDDISPWDQEFLRVEQPILFDLILAANYLDIKGLLDVCCK
TVANMIKGKTPEEIRKTFNIKNDFSPAEEEQIRKENEWCEEK
NT seq 489 nt   +upstreamnt  +downstreamnt
atgcctgacgtcattcttcaaagctctgacaatgagaactttaccgtgagtctggaagtg
gccaagatgtcggcgacggtgaagaccttgctcgaagatcttggttacgccgaggacaag
ccggatacaattcccttaccgaacgttcggggtgagattctacgacttgtggtcaactgg
tgcaatcagcacaagaacgacacccctttgcccgaggatgacgagggtcgtgaaaaacgg
accgacgacatttctccatgggaccaggagtttcttcgggtggagcaacccatcctgttc
gatctgattttggctgccaactacctcgatatcaaagggcttttggacgtctgctgcaaa
accgtggccaacatgatcaaaggcaagactcctgaagagatccgaaaaaccttcaacatc
aagaatgacttttctccagcggaagaagagcaaattcgcaaggaaaatgagtggtgtgag
gaaaagtga

DBGET integrated database retrieval system