Flagellatimonas centrodinii: JN531_014255 Help Entry JN531_014255      CDS       T07957                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fce  Flagellatimonas centrodinii Pathway fce01100   Metabolic pathways fce01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fce00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JN531_014255 (acpP)    00074 Mycolic acid biosynthesis     JN531_014255 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JN531_014255 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  ULQ46255 LinkDB All DBs Position 2949868..2950113 Genome browser AA seq 81 aa AA seqDB search MSSLEEKVKKIIAEQLSVAEDQITPEASFVEDLGADSLDTVELVMALEEEFEIDIPDEEA EKIVTFQDVLNYIRTHAPQNG NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagcagtctcgaagagaaagtcaagaagatcatcgcggagcagctttccgtggccgaa gaccagatcaccccggaagcttcgttcgtggaagatctcggtgccgattctcttgacacc gtggaactggtgatggcgctcgaagaggagttcgagatcgacatccccgatgaagaagcg gaaaagatcgtcaccttccaggacgttctcaactacatccgtacgcacgcgccgcaaaac ggctga

DBGET integrated database retrieval system