Flagellatimonas centrodinii: JN531_015540
Help
Entry
JN531_015540 CDS
T07957
Symbol
phoB
Name
(GenBank) phosphate regulon transcriptional regulator PhoB
KO
K07657
two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
fce
Flagellatimonas centrodinii
Pathway
fce02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
fce00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
JN531_015540 (phoB)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
fce02022
]
JN531_015540 (phoB)
Two-component system [BR:
fce02022
]
OmpR family
PhoR-PhoB (phosphate starvation response)
JN531_015540 (phoB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
Trans_reg_C
VpsR
PDE8A_N
Motif
Other DBs
NCBI-ProteinID:
ULQ46499
LinkDB
All DBs
Position
complement(3224562..3225254)
Genome browser
AA seq
230 aa
AA seq
DB search
MQNKLILVVEDEAAIREMVRFALTRAEYRVAEAGSAQEARLRMADERPDLILMDWMMPGI
SGVELTRELKGSASNRDIPVIMVTARAEEEDKIRGLNTGCDDYVSKPFSFPELLARIQAV
LRRSMPGGEEERLAVNGLEVDAASQRVTAQGQPVKLGPTEYRLLHFFVSHPERVYTREQV
LDRVWGQNVYVEERTVDVHIRRLRKALEPFGYADMIQTVRGTGYRFSEKY
NT seq
693 nt
NT seq
+upstream
nt +downstream
nt
atgcaaaacaagttgatcctggtggtagaggacgaggcggcgatccgcgagatggtgcgc
tttgccctgacccgcgcggagtaccgggtcgccgaggccggttcggcgcaggaggcccga
ctgcggatggctgacgagcgccccgatctgattctcatggactggatgatgccgggcatc
agcggggtcgaactgacgcgcgaactcaagggttcggcctcgaatcgcgacatcccggtg
atcatggtgaccgcgcgcgccgaggaggaggacaagatccgcggcctcaataccggttgc
gatgactacgtctcgaagccgttctcgttccccgagctgctggcccgcatccaggcggtg
ctgcgtcgcagcatgccgggaggcgaggaggagcgcctggcggtcaacgggcttgaggtc
gatgcggccagccagcgcgtgaccgcgcaggggcagccggtgaagctggggcctaccgaa
taccggctactgcacttcttcgtcagccatcccgagcgggtctacacccgtgaacaggtg
ctggatcgggtctgggggcagaacgtgtacgtcgaagagcggacggtggacgttcatatt
cgccgtctgcgcaaggcactggagcccttcggctatgccgacatgatccagaccgtgcgc
gggaccggctaccggttttccgaaaagtattga
DBGET
integrated database retrieval system