KEGG   Francisella cf. novicida Fx1: FNFX1_1712
Entry
FNFX1_1712        CDS       T01937                                 
Name
(GenBank) NADH-ubiquinone oxidoreductase chain J
  KO
K00339  NADH-quinone oxidoreductase subunit J [EC:7.1.1.2]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
fcf00190  Oxidative phosphorylation
fcf01100  Metabolic pathways
Module
fcf_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:fcf00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    FNFX1_1712
Enzymes [BR:fcf01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     FNFX1_1712
SSDB
Motif
Pfam: Oxidored_q3 DUF6057
Other DBs
NCBI-ProteinID: AEE88097
LinkDB
Position
complement(1789613..1790218)
AA seq 201 aa
MVVTDILFYTFASLAIISALVLVLANNPVNSVIAMIFTFIFTAAVWIILQQVYLALLLIV
VYVGAVLVMFLFVVFMLDLHVEEQGRVGRFFYALAAVVVCAIFATVISYAATNVFAGAMM
QGGVGGLKIIGLTMFSNANLYVFELVDFILLAAMTAAITLTLRAKRKGNKTVNPAQQVKV
RAKDRLTMVKMPSNNEGAKDE
NT seq 606 nt   +upstreamnt  +downstreamnt
atggttgtaacagatattttattttatacatttgcgtcacttgctatcatttctgcttta
gtactggttttagcaaataatccagtaaattctgtaatagcaatgatttttacattcata
tttacagctgcagtatggataatcttacaacaagtatatttagcattattgcttatagtg
gtttatgttggtgctgtgttagtgatgttcttatttgtagtttttatgctagatttgcat
gttgaggaacagggtagagttggtagatttttctatgctctagctgctgtggttgtctgt
gctatatttgctacagttataagttacgctgcaacaaatgtttttgccggagctatgatg
caaggcggagtcggtggtcttaagatcatcggtctaactatgtttagtaatgctaatttg
tatgtatttgagcttgttgactttattttattagcagctatgactgcagcgataacatta
acattaagagctaagcgaaaaggaaacaaaactgttaatccagctcagcaagttaaagtc
agagcaaaagatcgtctaaccatggtgaaaatgccaagtaataatgagggcgctaaagat
gaatag

DBGET integrated database retrieval system