Falco cherrug (Saker falcon): 102047075 Help Entry 102047075         CDS       T02911                                  Symbol CLDN5 Name (RefSeq) claudin-5   KO K06087   claudin Organism fch  Falco cherrug (Saker falcon) Pathway fch03272   Virion - Hepatitis viruses fch04382   Cornified envelope formation fch04514   Cell adhesion molecules fch04530   Tight junction Brite KEGG Orthology (KO) [BR:fch00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     102047075 (CLDN5)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102047075 (CLDN5)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     102047075 (CLDN5)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     102047075 (CLDN5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:fch03037]     102047075 (CLDN5)    04147 Exosome [BR:fch04147]     102047075 (CLDN5)    04515 Cell adhesion molecules [BR:fch04515]     102047075 (CLDN5) Cilium and associated proteins [BR:fch03037]  Other cilia and associated proteins   Stereociliary proteins    102047075 (CLDN5) Exosome [BR:fch04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    102047075 (CLDN5)   Exosomal proteins of colorectal cancer cells    102047075 (CLDN5) Cell adhesion molecules [BR:fch04515]  Immunoglobulin superfamily   L1 family    102047075 (CLDN5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 T4SS_CagC DUF2232 MFS_MOT1 Motif Other DBs NCBI-GeneID:  102047075 NCBI-ProteinID:  XP_005445360 LinkDB All DBs Position Unknown AA seq 176 aa AA seqDB search NIVVAQTIWEGLWMNCVVQSTGQMQCKVYDSILALRPEVQAGRALTVVVALLGLVALMVT VVGAQCTNCIRPGKMKSRVVIAGGAIYILCGVLVLIPLCWFANIVISDFYDPTVPSSQKR EMGAALYIGWAATALLLFGGCLICCCSCSQRDETSFPVKYSAPRRPTSHGEYDQKN NT seq 531 nt NT seq  +upstreamnt  +downstreamnt aacatcgtggtggcacagaccatctgggaagggctgtggatgaactgcgtggtgcagagc acggggcagatgcagtgcaaggtgtacgactccatcctagcgctgcggcccgaggtgcag gcaggccgggcactcaccgtcgttgtggcactgctggggctggtggcactgatggtgacc gtggtgggcgcgcagtgcaccaactgcatccgacccggcaagatgaagtcccgcgtcgtg atcgctggtggggccatctacattctctgcggggtcctggtcctcatcccactctgctgg ttcgccaacatcgtcatcagcgacttctatgaccccaccgtgccatcctcccagaagcga gagatgggggctgcgctctacatcggctgggcagccacggccctgctgctcttcgggggc tgcctcatctgctgctgctcctgctcccagcgcgacgagacctccttccccgtcaagtac tcggcgccgcggcggcccacctcccacggcgagtacgaccagaagaactaa

DBGET integrated database retrieval system