Falco cherrug (Saker falcon): 102047240 Help Entry 102047240         CDS       T02911                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism fch  Falco cherrug (Saker falcon) Brite KEGG Orthology (KO) [BR:fch00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fch03036]     102047240   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fch04147]     102047240 Chromosome and associated proteins [BR:fch03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102047240 Exosome [BR:fch04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102047240 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom Motif Other DBs NCBI-GeneID:  102047240 NCBI-ProteinID:  XP_027664118 LinkDB All DBs Position Unknown AA seq 114 aa AA seqDB search MLTNLFAILIIFLILSFHFERPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTD LRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgttgacgaatttatttgccatactaattatttttttaatattatcatttcatttcgaa aggccgggtaccgtggctctccgtgaaatcaggcgctaccaaaagtctaccgaacttttg atccgcaaacttcctttccagcgtctggtgcgtgaaattgctcaggacttcaaaacagat ctgcgcttccagagcgctgccatcggtgctttgcaggaggcaagtgaagcctacttggtt ggcctgtttgaagataccaacctgtgtgctatccatgccaaacgtgtcacaatcatgcca aaagatatccagctagcgcgccgcatacgtggagagcgtgcttaa

DBGET integrated database retrieval system