Falco cherrug (Saker falcon): 102048421 Help Entry 102048421         CDS       T02911                                  Symbol CLDN19 Name (RefSeq) claudin-19   KO K06087   claudin Organism fch  Falco cherrug (Saker falcon) Pathway fch03272   Virion - Hepatitis viruses fch04382   Cornified envelope formation fch04514   Cell adhesion molecule (CAM) interaction fch04530   Tight junction Brite KEGG Orthology (KO) [BR:fch00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     102048421 (CLDN19)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     102048421 (CLDN19)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     102048421 (CLDN19)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     102048421 (CLDN19)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:fch03037]     102048421 (CLDN19)    04147 Exosome [BR:fch04147]     102048421 (CLDN19) Cilium and associated proteins [BR:fch03037]  Other cilia and associated proteins   Stereociliary proteins    102048421 (CLDN19) Exosome [BR:fch04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    102048421 (CLDN19)   Exosomal proteins of colorectal cancer cells    102048421 (CLDN19) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF981 SK_channel CD20 H_PPase DUF2207_C Motif Other DBs NCBI-GeneID:  102048421 NCBI-ProteinID:  XP_014134275 LinkDB All DBs Position Unknown AA seq 143 aa AA seqDB search MARMTASLPLSAAVHIQISRALMVISLLLGFFGIIVSVVGMKCTKVGEEDPVTKSRIAVA GGILFILSGLCTLIAVSYYAMQVAHEFFDKNPFPANARGPLLSSPGPAKEQRGQQYYRQS QPSTAREPPVKMSSSPIRGEQCL NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atggcgaggatgacggcttctctgcccctctccgctgcagttcacatccagatctcccgg gctctcatggtgatttctctcctcctgggtttcttcggcatcattgtcagcgtggtgggc atgaaatgcaccaaagttggtgaagaggatcctgtcaccaagagccgcatcgctgtggct ggaggcatcctcttcatcctctccggtctgtgcaccttgatcgccgtgtcctactacgcc atgcaggtggcccacgagttcttcgacaagaaccccttccccgccaacgccaggggcccc ctcttgtcctcccccggccccgccaaggagcagcgaggccagcagtactatcggcagtcg cagccttcgacggctcgggaaccccctgtaaaaatgtcttcttcacccatcaggggagag cagtgcttatag

DBGET integrated database retrieval system