Falco cherrug (Saker falcon): 102048692 Help Entry 102048692         CDS       T02911                                  Symbol CDO1 Name (RefSeq) cysteine dioxygenase type 1   KO K00456   cysteine dioxygenase [EC:1.13.11.20] Organism fch  Falco cherrug (Saker falcon) Pathway fch00270   Cysteine and methionine metabolism fch00430   Taurine and hypotaurine metabolism fch01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:fch00001]  09100 Metabolism   09105 Amino acid metabolism    00270 Cysteine and methionine metabolism     102048692 (CDO1)   09106 Metabolism of other amino acids    00430 Taurine and hypotaurine metabolism     102048692 (CDO1) Enzymes [BR:fch01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.20  cysteine dioxygenase      102048692 (CDO1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CDO_I PCO_ADO Motif Other DBs NCBI-GeneID:  102048692 NCBI-ProteinID:  XP_027667707 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MILCWGEGHGSSIHDHTDSHCFMKILQGNLKETLFEWPEKKGNGEMTKKSERVLRENQCA YINDSIGLHRVENISHTESAVSLHLYSPPFDSCNTFDQRTGHKHKVKMTFYSQFGERTLC ATAVPQENN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgatcttgtgctggggtgaagggcatggcagcagcatccatgatcacactgactcacac tgctttatgaagatcctccagggaaatctaaaggagactctgttcgagtggcctgagaaa aaggggaatggtgaaatgactaagaaatcagaacgagttttgagggaaaatcaatgtgcc tacattaatgactccattggcctgcaccgtgtggagaacataagccacacagaatctgct gttagcctgcatttgtacagcccacccttcgacagctgtaacacctttgatcagcggact ggacacaagcacaaagtcaagatgaccttctacagccagtttggagaaaggactctctgt gcaacagcagtgccgcaggagaacaactga

DBGET integrated database retrieval system