Falco cherrug (Saker falcon): 102049160 Help Entry 102049160         CDS       T02911                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism fch  Falco cherrug (Saker falcon) Pathway fch04081   Hormone signaling fch04144   Endocytosis fch04150   mTOR signaling pathway fch04270   Vascular smooth muscle contraction fch04310   Wnt signaling pathway fch04350   TGF-beta signaling pathway fch04510   Focal adhesion fch04520   Adherens junction fch04530   Tight junction fch04621   NOD-like receptor signaling pathway fch04625   C-type lectin receptor signaling pathway fch04810   Regulation of actin cytoskeleton fch05100   Bacterial invasion of epithelial cells fch05132   Salmonella infection Brite KEGG Orthology (KO) [BR:fch00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     102049160 (RHOA)    04350 TGF-beta signaling pathway     102049160 (RHOA)    04150 mTOR signaling pathway     102049160 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     102049160 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102049160 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102049160 (RHOA)    04520 Adherens junction     102049160 (RHOA)    04530 Tight junction     102049160 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102049160 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102049160 (RHOA)    04625 C-type lectin receptor signaling pathway     102049160 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     102049160 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102049160 (RHOA)    05100 Bacterial invasion of epithelial cells     102049160 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fch04131]     102049160 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fch04147]     102049160 (RHOA)    04031 GTP-binding proteins [BR:fch04031]     102049160 (RHOA) Membrane trafficking [BR:fch04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     102049160 (RHOA) Exosome [BR:fch04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102049160 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    102049160 (RHOA)   Exosomal proteins of colorectal cancer cells    102049160 (RHOA)   Exosomal proteins of bladder cancer cells    102049160 (RHOA) GTP-binding proteins [BR:fch04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     102049160 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  102049160 NCBI-ProteinID:  XP_005432782 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcgaaaaaagctggttatagtgggtgatggtgcctgtggaaagacctgt ctgctgattgtatttagcaaagaccagttccctgaagtgtatgttcccaccgtctttgaa aattatgtagcagatatcgaagtggatggaaagcaggtggagttggctttgtgggataca gcaggacaagaagactatgatcgacttagaccgctttcttatccagatactgatgttata cttatgtgtttttcaattgatagtcctgatagtttagaaaacatcccagagaagtggacc ccggaggtgaagcatttctgccccaacgtgcctatcatcttggtaggaaacaagaaggac ctgaggaatgacgagcacacaagacgagagctggccaaaatgaagcaggagcctgtcaaa cctgaagaaggaagagatatggcaaaccgcattggtgcatttgggtatatggagtgttcg gcaaagaccaaagacggtgtgagggaggtttttgaaatggccactagagctgctttgcaa gcccggcgtggcaagaaaaagtccgggtgccttctcttataa

DBGET integrated database retrieval system