Falco cherrug (Saker falcon): 102049588 Help Entry 102049588         CDS       T02911                                  Symbol CALM1 Name (RefSeq) calmodulin-1   KO K02183   calmodulin Organism fch  Falco cherrug (Saker falcon) Pathway fch04020   Calcium signaling pathway fch04070   Phosphatidylinositol signaling system fch04114   Oocyte meiosis fch04218   Cellular senescence fch04261   Adrenergic signaling in cardiomyocytes fch04270   Vascular smooth muscle contraction fch04371   Apelin signaling pathway fch04625   C-type lectin receptor signaling pathway fch04744   Phototransduction fch04910   Insulin signaling pathway fch04912   GnRH signaling pathway fch04916   Melanogenesis Brite KEGG Orthology (KO) [BR:fch00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     102049588 (CALM1)    04020 Calcium signaling pathway     102049588 (CALM1)    04070 Phosphatidylinositol signaling system     102049588 (CALM1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102049588 (CALM1)    04218 Cellular senescence     102049588 (CALM1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102049588 (CALM1)   09152 Endocrine system    04910 Insulin signaling pathway     102049588 (CALM1)    04912 GnRH signaling pathway     102049588 (CALM1)    04916 Melanogenesis     102049588 (CALM1)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102049588 (CALM1)    04270 Vascular smooth muscle contraction     102049588 (CALM1)   09157 Sensory system    04744 Phototransduction     102049588 (CALM1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:fch01009]     102049588 (CALM1)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fch04131]     102049588 (CALM1)    03036 Chromosome and associated proteins [BR:fch03036]     102049588 (CALM1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fch04147]     102049588 (CALM1) Protein phosphatases and associated proteins [BR:fch01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102049588 (CALM1) Membrane trafficking [BR:fch04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     102049588 (CALM1) Chromosome and associated proteins [BR:fch03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      102049588 (CALM1) Exosome [BR:fch04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102049588 (CALM1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 EH EF-hand_11 EFhand_Ca_insen EF_EFCAB10_C EF-hand_EFHB_C UPF0154 SPARC_Ca_bdg DUF1103 DUF5580_M Dockerin_1 EF-hand_STIM1 SAPC2_N FCaBP_EF-hand SPEF2_C SurA_N_3 Poly_export Motif Other DBs NCBI-GeneID:  102049588 NCBI-ProteinID:  XP_014135171 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKD GNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgaggtcgttgggtcaaaatccaacagaagcagaattgcaggatatgatcaacgaggta gatgctgatggcaatggcactattgacttccctgagtttttaaccatgatggccagaaaa atgaaggacacagacagcgaggaggaaatccgtgaggcattccgagtctttgacaaggat ggcaatggctatatcagtgcagcagaactacgtcatgttatgacaaacttaggagaaaag ctaacagatgaagaagtagacgaaatgatcagagaagcagacattgatggggatgggcaa gtcaactatgaagaattcgtacagatgatgactgcaaagtga

DBGET integrated database retrieval system