Falco cherrug (Saker falcon): 102052474 Help Entry 102052474         CDS       T02911                                  Symbol DCTN6 Name (RefSeq) dynactin subunit 6   KO K10428   dynactin 6 Organism fch  Falco cherrug (Saker falcon) Pathway fch04814   Motor proteins fch05132   Salmonella infection Brite KEGG Orthology (KO) [BR:fch00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     102052474 (DCTN6)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102052474 (DCTN6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fch03036]     102052474 (DCTN6)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:fch04812]     102052474 (DCTN6) Chromosome and associated proteins [BR:fch03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Dynactin complex      102052474 (DCTN6) Cytoskeleton proteins [BR:fch04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dynactins      102052474 (DCTN6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DCTN5 Hexapep Motif Other DBs NCBI-GeneID:  102052474 NCBI-ProteinID:  XP_005435389 LinkDB All DBs Position Unknown AA seq 133 aa AA seqDB search MYSSIFHRYPENITPEAEEVEPKPMVIGTNNVFEVGCYSQAMKVGDNNVIESKAFVGRNV ILTSGCIIGVCCNVNTYEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHL KKTMKAASTPVKS NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgtattcttccatcttccacaggtatccagagaatattacacccgaagcggaggaggtg gagcccaagccaatggtcattggcaccaacaatgtttttgaggttgggtgttattcccaa gcaatgaaggtgggagataacaacgtcattgaatccaaagcatttgttggcaggaatgtg atcctgacgagtggctgcatcatcggggtctgctgtaatgtcaacacctacgaggtgatc cctgaaaacaccgtcatctatggggctgactgcctgcgccgtgtccagaccgagcggcca cagccccagacgctgcagctggatttcctgatgaagatcttgccaaactaccatcaccta aagaagaccatgaaggccgcgtccactccggtcaagagctga

DBGET integrated database retrieval system