Falco cherrug (Saker falcon): 102053823 Help Entry 102053823         CDS       T02911                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism fch  Falco cherrug (Saker falcon) Pathway fch04382   Cornified envelope formation fch05132   Salmonella infection Brite KEGG Orthology (KO) [BR:fch00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     102053823 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102053823 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fch04147]     102053823 (S100A10) Exosome [BR:fch04147]  Exosomal proteins   Exosomal proteins of microglial cells    102053823 (S100A10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 Motif Other DBs NCBI-GeneID:  102053823 NCBI-ProteinID:  XP_005442632 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSQMEHAMETLMFTFHKYAGDKNHLGKEDLRALMEKEFPGFLENQQDPMALDKIMKDLD QCRDGKVGFQGFFSLVAGLTIACNDYFVLHMKQKGRK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtcccagatggagcacgccatggagaccctcatgttcaccttccacaagtacgcg ggtgacaagaaccacctgggcaaggaggacctgcgggcgctgatggagaaggagttcccc ggcttcctggagaaccagcaggacccgatggccctggacaagatcatgaaggacctggac cagtgccgggacggcaaggtgggcttccagggcttcttctcgctggtggccgggctcacc atcgcctgcaacgactactttgtcctgcacatgaagcagaagggcaggaagtga

DBGET integrated database retrieval system