Falco cherrug (Saker falcon): 102054781 Help Entry 102054781         CDS       T02911                                  Symbol ARF6 Name (RefSeq) ADP-ribosylation factor 6   KO K07941   ADP-ribosylation factor 6 Organism fch  Falco cherrug (Saker falcon) Pathway fch04144   Endocytosis fch04517   IgSF CAM signaling fch05132   Salmonella infection Brite KEGG Orthology (KO) [BR:fch00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     102054781 (ARF6)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102054781 (ARF6)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102054781 (ARF6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fch04131]     102054781 (ARF6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fch04147]     102054781 (ARF6)    04031 GTP-binding proteins [BR:fch04031]     102054781 (ARF6) Membrane trafficking [BR:fch04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     102054781 (ARF6)   Arf GTPases and associated proteins    Arf GTPases     102054781 (ARF6) Exosome [BR:fch04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102054781 (ARF6)   Exosomal proteins of colorectal cancer cells    102054781 (ARF6) GTP-binding proteins [BR:fch04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     102054781 (ARF6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SpoOE-like CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  102054781 NCBI-ProteinID:  XP_005436061 LinkDB All DBs Position Unknown AA seq 175 aa AA seqDB search MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTGDGLYEGLTWLTSNYKS NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atgggcaaggtgctgtccaagatcttcggcaacaaggagatgcggatcctgatgctgggt ctggacgcggctggtaaaaccaccatcctgtacaaactgaagctgggccagtccgtcacc accatccccaccgtgggcttcaacgtggagacggttacttacaaaaacgtcaagttcaac gtgtgggatgtcgggggccaggacaagatccgtcccctctggaggcactactacacgggc acgcaagggttgatctttgtggtggactgcgccgatcgcgaccgcatcgacgaggcccgc caggagctccaccgcattatcaacgacagggagatgcgggacgccatcatcctcatcttc gccaacaagcaggacctgcctgatgccatgaaaccccatgaaatccaggagaaactgggc ctgacccgaatcagggataggaattggtatgtgcagccctcctgtgctactacaggggat ggactctatgaagggctgacatggttaacatccaattataaatcctaa

DBGET integrated database retrieval system