Falco cherrug (Saker falcon): 102055506 Help Entry 102055506         CDS       T02911                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism fch  Falco cherrug (Saker falcon) Pathway fch04010   MAPK signaling pathway fch04012   ErbB signaling pathway fch04068   FoxO signaling pathway fch04137   Mitophagy - animal fch04140   Autophagy - animal fch04144   Endocytosis fch04150   mTOR signaling pathway fch04210   Apoptosis fch04218   Cellular senescence fch04370   VEGF signaling pathway fch04371   Apelin signaling pathway fch04510   Focal adhesion fch04540   Gap junction fch04625   C-type lectin receptor signaling pathway fch04810   Regulation of actin cytoskeleton fch04910   Insulin signaling pathway fch04912   GnRH signaling pathway fch04916   Melanogenesis fch05132   Salmonella infection Brite KEGG Orthology (KO) [BR:fch00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102055506 (HRAS)    04012 ErbB signaling pathway     102055506 (HRAS)    04370 VEGF signaling pathway     102055506 (HRAS)    04371 Apelin signaling pathway     102055506 (HRAS)    04068 FoxO signaling pathway     102055506 (HRAS)    04150 mTOR signaling pathway     102055506 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102055506 (HRAS)    04140 Autophagy - animal     102055506 (HRAS)    04137 Mitophagy - animal     102055506 (HRAS)   09143 Cell growth and death    04210 Apoptosis     102055506 (HRAS)    04218 Cellular senescence     102055506 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102055506 (HRAS)    04540 Gap junction     102055506 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102055506 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102055506 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     102055506 (HRAS)    04912 GnRH signaling pathway     102055506 (HRAS)    04916 Melanogenesis     102055506 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102055506 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fch04131]     102055506 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fch04147]     102055506 (HRAS)    04031 GTP-binding proteins [BR:fch04031]     102055506 (HRAS) Membrane trafficking [BR:fch04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     102055506 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     102055506 (HRAS) Exosome [BR:fch04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102055506 (HRAS)   Exosomal proteins of colorectal cancer cells    102055506 (HRAS) GTP-binding proteins [BR:fch04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102055506 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  102055506 NCBI-ProteinID:  XP_014138307 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataagctggtggtggtgggagctggtggtgtcgggaagagtgctttgacg atacagctcattcagaaccatttcgttgatgagtatgaccccacgatagaggattcctac agaaagcaagtcgtcatcgatggagagacctgcttgttagacatcttggataccgcaggg caggaagagtacagtgccatgagagaccagtacatgagaacgggggaaggattcctctgc gtcttcgccatcaataacaccaagtcctttgaagacattcaccagtacagggagcagatc aagagggtgaaagactcagatgatgttcccatggtgctggtgggaaataaatgtgacctg ccagcccggacagtggagacccggcaagcgcaggacctggcccggagttacgggatcccc tacatagaaacctctgccaaaaccagacagggcgttgaagatgccttctacaccttggtg cgggagatccggcagcacaagctgcgcaaactgaatcccccagacgagagcggccctggc tgcatgaactgtaaatgtgtgatatcgtga

DBGET integrated database retrieval system