Falco cherrug (Saker falcon): 102056940 Help Entry 102056940         CDS       T02911                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism fch  Falco cherrug (Saker falcon) Pathway fch04060   Cytokine-cytokine receptor interaction fch04218   Cellular senescence fch04620   Toll-like receptor signaling pathway fch04621   NOD-like receptor signaling pathway fch04622   RIG-I-like receptor signaling pathway fch05132   Salmonella infection fch05164   Influenza A Brite KEGG Orthology (KO) [BR:fch00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102056940  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     102056940  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102056940    04621 NOD-like receptor signaling pathway     102056940    04622 RIG-I-like receptor signaling pathway     102056940  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     102056940   09171 Infectious disease: bacterial    05132 Salmonella infection     102056940  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:fch04052]     102056940    00536 Glycosaminoglycan binding proteins [BR:fch00536]     102056940 Cytokines and neuropeptides [BR:fch04052]  Cytokines   Chemokines    102056940 Glycosaminoglycan binding proteins [BR:fch00536]  Heparan sulfate / Heparin   Chemokines    102056940 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  102056940 NCBI-ProteinID:  XP_027655672 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search MMGKAVAAVLTLLLISAVGTKGKALPRSAMELRCQCIDTHSKFIHPKFIHNVNLTPSGPH CKDVEVIATLTDGREVCLDPTAPWVKLIIKGILDK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgatgggcaaagctgtggctgctgtcctgactcttctcctgatctcagcggttggaaca aaaggtaaggcactgccacgctcagcgatggagctccggtgccagtgcatagacacccat tcgaagttcatccaccccaagttcattcataatgtgaacctcacccccagcggacctcac tgcaaggatgttgaagtcatagctaccttgacagatggcagagaagtgtgcctggacccc actgctccctgggtgaagctgatcatcaagggaattctggacaagtga

DBGET integrated database retrieval system