Falco cherrug (Saker falcon): 106631313 Help Entry 106631313         CDS       T02911                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism fch  Falco cherrug (Saker falcon) Pathway fch03082   ATP-dependent chromatin remodeling fch04217   Necroptosis Brite KEGG Orthology (KO) [BR:fch00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     106631313  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     106631313  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fch03036]     106631313   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fch04147]     106631313 Chromosome and associated proteins [BR:fch03036]  Eukaryotic type   Nucleosome assembly factors    Histones     106631313 Exosome [BR:fch04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106631313 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  106631313 NCBI-ProteinID:  XP_014137086 LinkDB All DBs Position Unknown AA seq 66 aa AA seqDB search MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLADLT AEILEP NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgtccggccgcgggaagcagggaggcaaagtccgggccaaggccaagtcgcgctcgtcg cgggccgggctgcagttccccgtgggccgcgtgcaccggctgctgcgcaagggcaactac gcggagcgggtgggcgcgggagcgcccgtctacatggcggccgtgctggcggacctgacg gccgagatcctggagccg

DBGET integrated database retrieval system