KEGG Orthology (KO) [BR:fch00001]
09120 Genetic Information Processing
09121 Transcription
03040 Spliceosome
106631673 (BCAS2)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03041 Spliceosome [BR:fch03041]
106631673 (BCAS2)
03400 DNA repair and recombination proteins [BR:fch03400]
106631673 (BCAS2)
Spliceosome [BR:fch03041]
Complex B
Other components
Prp19 complex
106631673 (BCAS2)
Complex C
Prp19-CDC5 complex
106631673 (BCAS2)
DNA repair and recombination proteins [BR:fch03400]
Eukaryotic type
Other factors with a suspected DNA repair function
PSO4 complex
106631673 (BCAS2)
143 aa
MKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNEHLV
HMIEQAQKELQKLRKNIQDLNWQRKNMQLTAGAKLREMESTWVSLVSKNYEIERTIVQLE
NEISQIKQQHGEANKENIQQDFQ